Gene Information

Name : mtrA (B737_2983)
Accession : YP_008459315.1
Strain : Amycolatopsis mediterranei RB
Genome accession: NC_022116
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3230548 - 3231237 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
GTGGCCGAGGTACTGGTGGTAGAGGACGACGCGGCGGTGCGGGAGGGACTGCAGCTGGCCCTGCGCAGGCAGGGGCACGT
GGTGCACACCGCGGAATCGGGCGAGCTCGGCATCGAGGTGCTCGTGCGCCACCGGCCCGACCTGGTCGTGCTCGACCTGA
TGCTGCCCGGCATGGACGGCTTCGAGACCTGCCGCCGGATGCGGGCGGCCGGCCCGGTCCCGATCATCATGCTCACCGCG
CGCACCGACGACTTCGACATCGTGGCCGGGCTGGAAGCGGGCGCGGACGACTACGTTGCCAAGCCGGTCGAACCACGGGT
GCTGGACGCCCGGATCCGGGCCGTCCTGCGCCGGGCGGCCGTCGAACGACCGGACGGGCCGGCGGCGGCCGAGGAGCGGC
ACGGCGACCTGGTGATCGACCGGGCCGCGCTCGAGGTGACCAAGCGCGGCGAGCCGGTGTCGCTGACCCCGACCGAGCTG
AAGCTGCTGCTGGAGCTCTCGCGCACGCCCGGGCAGGTGTACAGCCGCCAGCAGATCCTCTCCGCCGTGTGGGACCACGA
CTACCTCGGGGACTCCCGGCTCGTCGACGCCTGCGTGCAGCGGCTGCGGGCGAAGATCGAGGACGTGCCGGCGAAACCGG
AGCACGTGCAGACGGTCCGCGGGTTCGGCTACCGGTTCGGCCGGTCGTGA

Protein sequence :
MAEVLVVEDDAAVREGLQLALRRQGHVVHTAESGELGIEVLVRHRPDLVVLDLMLPGMDGFETCRRMRAAGPVPIIMLTA
RTDDFDIVAGLEAGADDYVAKPVEPRVLDARIRAVLRRAAVERPDGPAAAEERHGDLVIDRAALEVTKRGEPVSLTPTEL
KLLLELSRTPGQVYSRQQILSAVWDHDYLGDSRLVDACVQRLRAKIEDVPAKPEHVQTVRGFGYRFGRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 4e-17 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008459315.1 two-component system response regulator AE000516.2.gene3505. Protein 7e-31 48
mtrA YP_008459315.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-29 44
mtrA YP_008459315.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-29 44
mtrA YP_008459315.1 two-component system response regulator NC_002952.2859905.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_002758.1121668.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_003923.1003749.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_009641.5332272.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_013450.8614421.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_007793.3914279.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_007622.3794472.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_002745.1124361.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_009782.5559369.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator NC_002951.3237708.p0 Protein 5e-28 42
mtrA YP_008459315.1 two-component system response regulator CP000034.1.gene3671. Protein 6e-23 42
mtrA YP_008459315.1 two-component system response regulator NC_010410.6002989.p0 Protein 1e-18 42
mtrA YP_008459315.1 two-component system response regulator NC_011595.7057856.p0 Protein 1e-18 42
mtrA YP_008459315.1 two-component system response regulator BAC0197 Protein 2e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008459315.1 two-component system response regulator VFG1563 Protein 2e-19 41