Gene Information

Name : O5Y_10360 (O5Y_10360)
Accession : YP_008452660.1
Strain : Rhodococcus erythropolis CCM2595
Genome accession: NC_022115
Putative virulence/resistance : Virulence
Product : two-component response regulator MtrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2234891 - 2235568 bp
Length : 678 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAACCAAGGATTCTGGTTGTCGACGACGACACGGCACTCGCCGAGATGCTCACGATCGTGCTGCGTGGTGAGGGTTT
CGATCCCTACGTGGTGGGCGACGGAACCCTGGCGCTCGCGGCAGTGCGTGAGACGCGCCCTGATCTCGTCCTGCTCGATC
TCATGCTTCCCGGAATGAACGGGATCGACGTATGCCGGGTTCTGCGTGCGGATTCCGGTGTGCCCATCGTGATGTTGACG
GCCAAGACCGACACCGTCGACGTCGTGCTCGGCCTCGAATCCGGTGCGGACGACTACATCATGAAGCCGTTCAAGCCGAA
GGAGTTGGTGGCGCGAGTTCGCGCTCGCCTGCGCCGCACCGAAGAGGAACCGGCCGAGCTGCTGAGCATCGCCGACATCG
TGATCGACGTTCCGGCGCACAAGGTCAGCCGCGGCAGCGAGCAGATCTCGCTCACACCACTCGAATTCGACCTGCTGGTC
GCATTGGCGCGCAAACCGCGCCAGGTGTTCACCCGTGAAGTCCTCCTCGAGCAGGTGTGGGGATACCGCCACGCCGCCGA
TACCCGTCTGGTGAACGTGCACGTTCAGCGTTTGCGCGCCAAGGTCGAAACTGATCCCGAGAATCCCGAAGTGGTTCTGA
CGGTCAGGGGGGTCGGCTACAAGGCCGGACCGCCGTGA

Protein sequence :
MKPRILVVDDDTALAEMLTIVLRGEGFDPYVVGDGTLALAAVRETRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLT
AKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRTEEEPAELLSIADIVIDVPAHKVSRGSEQISLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKVETDPENPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O5Y_10360 YP_008452660.1 two-component response regulator MtrA AE000516.2.gene3505. Protein 2e-89 90
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_002952.2859905.p0 Protein 2e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_009782.5559369.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_002951.3237708.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_003923.1003749.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_002758.1121668.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_007622.3794472.p0 Protein 2e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_009641.5332272.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_013450.8614421.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_007793.3914279.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_002745.1124361.p0 Protein 3e-41 46
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_012469.1.7686381. Protein 1e-37 45
O5Y_10360 YP_008452660.1 two-component response regulator MtrA BAC0125 Protein 2e-30 44
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_012469.1.7685629. Protein 2e-36 43
O5Y_10360 YP_008452660.1 two-component response regulator MtrA HE999704.1.gene2815. Protein 4e-37 43
O5Y_10360 YP_008452660.1 two-component response regulator MtrA CP001918.1.gene3444. Protein 2e-36 43
O5Y_10360 YP_008452660.1 two-component response regulator MtrA AE015929.1.gene1106. Protein 2e-30 42
O5Y_10360 YP_008452660.1 two-component response regulator MtrA CP000647.1.gene2531. Protein 3e-35 42
O5Y_10360 YP_008452660.1 two-component response regulator MtrA BAC0347 Protein 2e-22 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA BAC0111 Protein 3e-26 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA HE999704.1.gene1528. Protein 5e-34 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA CP000675.2.gene1535. Protein 2e-29 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA FJ349556.1.orf0.gene Protein 1e-31 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA BAC0197 Protein 2e-26 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA BAC0039 Protein 9e-36 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA CP001138.1.gene2239. Protein 3e-35 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA CP000034.1.gene2186. Protein 9e-36 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA NC_002695.1.916589.p Protein 7e-36 41
O5Y_10360 YP_008452660.1 two-component response regulator MtrA BAC0596 Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O5Y_10360 YP_008452660.1 two-component response regulator MtrA VFG1390 Protein 5e-32 45
O5Y_10360 YP_008452660.1 two-component response regulator MtrA VFG1702 Protein 6e-34 42
O5Y_10360 YP_008452660.1 two-component response regulator MtrA VFG1389 Protein 1e-26 42
O5Y_10360 YP_008452660.1 two-component response regulator MtrA VFG1563 Protein 5e-34 41