Gene Information

Name : LBPG_01414 (LBPG_01414)
Accession : YP_008447941.1
Strain : Lactobacillus paracasei 8700:2
Genome accession: NC_022112
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2823544 - 2824260 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
ATGATGGCGAAAAAAATCCTGGTCGTTGACGATGAGAAGCCTATCTCTGATATCGTCAAGTTTAATTTGGATAAAGAAGG
TTACGATGTCGTAACCGCTTATGATGGCGAAGAAGCCTTGAAAAAAGTCGAAGCAGAGTCACCCGACTTAATTTTACTTG
ATCTGATGTTACCAAAAATTGATGGGCTTGAAGTCGCCCGACAAATTCGTAAAGAACATGACACCCCAATTATTATGCTG
ACAGCTAAGGACTCAGAAATTGATAAAGTGCTCGGGTTGGAACTCGGTGCTGACGATTACGTCACCAAACCATTTTCCAA
TCGTGAACTGGTGGCACGTGTCAAAGCTAACTTGCGCCGAACCGCATCATCCAACGCAGCCAGCAATGAAGAAGACGAAG
CAAACAAGGAATTAGAAGTCGGAGATCTAACGATTCACCCCGATGCCTATACAGTCTCTAAACGCGGTGAAAACATCGAA
TTAACCCACCGTGAATTTGAGCTGCTGCACTACCTTGCTCGACACCTTGGGCAGGTCATGACCCGTGAGCATCTGCTGCA
AACCGTTTGGGGCTACGATTACTTTGGTGATGTCCGCACCGTCGATGTGACCGTCCGCCGTCTGCGTGAAAAAATCGAAG
ACAACCCGTCTCACCCTGAATGGCTGGTGACTCGACGCGGTGTCGGTTACTATCTGCGGAATCCCGATGCTGAATAA

Protein sequence :
MMAKKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALKKVEAESPDLILLDLMLPKIDGLEVARQIRKEHDTPIIML
TAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRRTASSNAASNEEDEANKELEVGDLTIHPDAYTVSKRGENIE
LTHREFELLHYLARHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPEWLVTRRGVGYYLRNPDAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 1e-32 41
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 1e-32 41
kdpE BAA82188.1 KDP operon transcriptional regulatory protein KdpE Not tested Type-II SCCmec Protein 3e-25 41
kdpE YP_039536.1 response regulator protein Not tested Type-II SCCmec Protein 4e-25 41
kdpE NP_370594.1 transcriptional regulator kdpE Not tested Type-II SCCmec Protein 4e-25 41
kdpE NP_373306.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-25 41
kdeP YP_190033.1 DNA-binding response regulator KdeP Not tested Type-II SCCmec Protein 4e-25 41
SH0031 YP_251946.1 hypothetical protein Not tested SCCmec Protein 1e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_012469.1.7685629. Protein 1e-71 72
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 3e-55 55
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 2e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 1e-55 54
LBPG_01414 YP_008447941.1 DNA-binding response regulator HE999704.1.gene2815. Protein 9e-50 52
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-44 49
LBPG_01414 YP_008447941.1 DNA-binding response regulator AE016830.1.gene1681. Protein 4e-48 48
LBPG_01414 YP_008447941.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 3e-41 48
LBPG_01414 YP_008447941.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 6e-40 46
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP001918.1.gene5135. Protein 2e-31 46
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP004022.1.gene3215. Protein 3e-39 46
LBPG_01414 YP_008447941.1 DNA-binding response regulator AF162694.1.orf4.gene Protein 3e-36 45
LBPG_01414 YP_008447941.1 DNA-binding response regulator BAC0533 Protein 2e-35 45
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP000034.1.gene3834. Protein 1e-35 45
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP000647.1.gene4257. Protein 2e-35 45
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002695.1.915041.p Protein 1e-35 45
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP001138.1.gene4273. Protein 2e-35 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator AE000516.2.gene3505. Protein 2e-37 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 7e-38 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator EU250284.1.orf4.gene Protein 5e-38 43
LBPG_01414 YP_008447941.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 1e-39 43
LBPG_01414 YP_008447941.1 DNA-binding response regulator AM180355.1.gene1830. Protein 2e-40 43
LBPG_01414 YP_008447941.1 DNA-binding response regulator AE015929.1.gene1106. Protein 6e-31 43
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP000034.1.gene2186. Protein 5e-31 43
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_002695.1.916589.p Protein 3e-31 43
LBPG_01414 YP_008447941.1 DNA-binding response regulator BAC0039 Protein 5e-31 43
LBPG_01414 YP_008447941.1 DNA-binding response regulator AF130997.1.orf0.gene Protein 2e-37 42
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP001138.1.gene2239. Protein 1e-29 42
LBPG_01414 YP_008447941.1 DNA-binding response regulator CP001918.1.gene3444. Protein 2e-29 42
LBPG_01414 YP_008447941.1 DNA-binding response regulator BAC0596 Protein 1e-29 42
LBPG_01414 YP_008447941.1 DNA-binding response regulator HE999704.1.gene1528. Protein 8e-30 41
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_011586.7046392.p0 Protein 1e-23 41
LBPG_01414 YP_008447941.1 DNA-binding response regulator NC_010410.6002907.p0 Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LBPG_01414 YP_008447941.1 DNA-binding response regulator VFG1389 Protein 2e-31 44
LBPG_01414 YP_008447941.1 DNA-binding response regulator VFG1563 Protein 8e-33 42
LBPG_01414 YP_008447941.1 DNA-binding response regulator VFG1702 Protein 6e-33 42
LBPG_01414 YP_008447941.1 DNA-binding response regulator VFG1390 Protein 8e-35 41
LBPG_01414 YP_008447941.1 DNA-binding response regulator VFG1386 Protein 6e-33 41