Gene Information

Name : LBPG_00957 (LBPG_00957)
Accession : YP_008446940.1
Strain : Lactobacillus paracasei 8700:2
Genome accession: NC_022112
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1714527 - 1715213 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGAGTAAAATATTAATTATTGAAGATGAAAAAAATTTAGCGCGGTTTGTCGAACTGGAATTAAAACACGAGGGCTATGA
GACCGAAGTGCATTTTAACGGTCGAACCGGGTTGGAAGCGGCTTTGGCTGAGGACTGGGATGCCATCCTACTTGACTTGA
TGTTGCCAGAATTAAACGGCCTTGAAGTTTGCCGGCGCGTTCGTCAGGTGAAGAATACACCGATCATTATGATGACCGCG
CGGGATTCTGTCATTGATCGCGTCAGTGGCTTGGATCATGGCGCTGATGACTACATTGTGAAGCCATTTGCCATTGAAGA
ATTACTCGCGCGCTTGCGTGCTTTGTTGCGCCGAATCAGCATTGAAGGCGAAAACAACACCGCTAAGCAGACAACCATCA
AATATCGTGATTTAGTGATTGAAAAAGAAAATCGCGTTGTTCGGCGCGGTGACGACATTATTGAATTAACCAAACGTGAG
TACGAATTATTGCTGACGCTTATGGAAAATGTCAATGTTGTTTTGGCTCGTGACGTTTTGCTCTCAAAGGTTTGGGGTTA
CAACTCTGACGTGGAAACGAATGTTGTTGACGTTTATGTCCGTTATATTCGTAATAAAATCGATCGACCGGGTGAACCGA
GTTATATTCAAACGGTTCGGGGAACCGGCTATGTTATGCGTTCGTAA

Protein sequence :
MSKILIIEDEKNLARFVELELKHEGYETEVHFNGRTGLEAALAEDWDAILLDLMLPELNGLEVCRRVRQVKNTPIIMMTA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRALLRRISIEGENNTAKQTTIKYRDLVIEKENRVVRRGDDIIELTKRE
YELLLTLMENVNVVLARDVLLSKVWGYNSDVETNVVDVYVRYIRNKIDRPGEPSYIQTVRGTGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-27 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LBPG_00957 YP_008446940.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-79 78
LBPG_00957 YP_008446940.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-47 53
LBPG_00957 YP_008446940.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-43 52
LBPG_00957 YP_008446940.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-38 44
LBPG_00957 YP_008446940.1 two-component system response regulator BAC0308 Protein 9e-31 43
LBPG_00957 YP_008446940.1 two-component system response regulator BAC0125 Protein 3e-29 43
LBPG_00957 YP_008446940.1 two-component system response regulator BAC0197 Protein 3e-28 42
LBPG_00957 YP_008446940.1 two-component system response regulator BAC0638 Protein 2e-25 42
LBPG_00957 YP_008446940.1 two-component system response regulator HE999704.1.gene2815. Protein 3e-32 42
LBPG_00957 YP_008446940.1 two-component system response regulator BAC0111 Protein 3e-27 41
LBPG_00957 YP_008446940.1 two-component system response regulator BAC0083 Protein 4e-28 41
LBPG_00957 YP_008446940.1 two-component system response regulator NC_012469.1.7686381. Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LBPG_00957 YP_008446940.1 two-component system response regulator VFG1390 Protein 5e-37 44
LBPG_00957 YP_008446940.1 two-component system response regulator VFG0596 Protein 4e-28 43
LBPG_00957 YP_008446940.1 two-component system response regulator VFG1389 Protein 1e-31 42
LBPG_00957 YP_008446940.1 two-component system response regulator VFG1702 Protein 8e-30 41