Gene Information

Name : yclJ (BASU_0357)
Accession : YP_008419803.1
Strain : Bacillus amyloliquefaciens UCMB5113
Genome accession: NC_022081
Putative virulence/resistance : Virulence
Product : two-component response regulator [YclK]
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 396136 - 396819 bp
Length : 684 bp
Strand : +
Note : Evidence 2a:Function of homologous gene experimentally demonstrated in an other organism; PubMedId:11717295, 15375128, 20512483; Product type r:regulator

DNA sequence :
ATGAAGATATTAATGATAGAAGACAATATAAGCGTATGCACCATGACGGAAATGTTCTTTTTTAAAGAAGGATTTGAAGC
CGAATTTGTCCATGACGGAGTGGAAGGCTATCAGCGGTTCACGGAAGAGGACTGGGATTTGGTCATTCTGGACATTATGC
TTCCATCCATGGACGGAGTGACGATCTGCCGGAAAATAAGAGAGACGAGCAGTGTGCCGATTATTATGCTGACCGCAAAG
GACACGGAGTCTGATCAGGTGATCGGGTTTGAAATGGGGGCGGACGACTATGTCACCAAGCCGTTCAGCCCGCTGACGCT
AGTAGCGCGGATTAAAGCGGTGATCAGAAGATACCGGGCGACGGGGCAGGCCGTAAAAAGCGACGACTTGATCGAAACGG
CGTGTTTTTCAATCAATAAGAAGACGCGGGAAGTGTTTCTGCACGGAAAACCTGTCGAGAATCTGACGCCGAAGGAATTC
GATCTGCTCTTTTATCTCGCACAAAACCCGCGCCAGGTCTTTTCGAGAGAGCAGCTGCTTGAGCAGGTGTGGGGCTATCA
ATTTTACGGCGATGAACGTACGGTTGATGTTCATATTAAACGGCTGCGCAAAAAACTGTCCAGTGAGGAAAAACCGTTTT
TATACACGGTGTGGGGGGTAGGATACAAATTTGATGAGGATTAA

Protein sequence :
MKILMIEDNISVCTMTEMFFFKEGFEAEFVHDGVEGYQRFTEEDWDLVILDIMLPSMDGVTICRKIRETSSVPIIMLTAK
DTESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYRATGQAVKSDDLIETACFSINKKTREVFLHGKPVENLTPKEF
DLLFYLAQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLSSEEKPFLYTVWGVGYKFDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-41 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-40 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_008419803.1 two-component response regulator [YclK] NC_012469.1.7685629. Protein 2e-41 45
yclJ YP_008419803.1 two-component response regulator [YclK] NC_002952.2859905.p0 Protein 4e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_002745.1124361.p0 Protein 5e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_009782.5559369.p0 Protein 5e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_002951.3237708.p0 Protein 5e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_003923.1003749.p0 Protein 4e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_002758.1121668.p0 Protein 5e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_007622.3794472.p0 Protein 3e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_009641.5332272.p0 Protein 5e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_013450.8614421.p0 Protein 5e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] NC_007793.3914279.p0 Protein 5e-43 44
yclJ YP_008419803.1 two-component response regulator [YclK] AF155139.2.orf0.gene Protein 1e-42 43
yclJ YP_008419803.1 two-component response regulator [YclK] HE999704.1.gene2815. Protein 7e-45 43
yclJ YP_008419803.1 two-component response regulator [YclK] DQ212986.1.gene4.p01 Protein 1e-38 42
yclJ YP_008419803.1 two-component response regulator [YclK] AE016830.1.gene1681. Protein 2e-41 42
yclJ YP_008419803.1 two-component response regulator [YclK] AE000516.2.gene3505. Protein 3e-39 42
yclJ YP_008419803.1 two-component response regulator [YclK] AE015929.1.gene1106. Protein 2e-29 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_003923.1003417.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_013450.8614146.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_002951.3238224.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_007793.3914065.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_002758.1121390.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_010079.5776364.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_002952.2859858.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_007622.3794948.p0 Protein 2e-34 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_010410.6002989.p0 Protein 2e-38 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_010400.5986590.p0 Protein 9e-38 41
yclJ YP_008419803.1 two-component response regulator [YclK] NC_011595.7057856.p0 Protein 2e-38 41
yclJ YP_008419803.1 two-component response regulator [YclK] FJ349556.1.orf0.gene Protein 2e-41 41
yclJ YP_008419803.1 two-component response regulator [YclK] AM180355.1.gene1830. Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_008419803.1 two-component response regulator [YclK] VFG1563 Protein 1e-41 46
yclJ YP_008419803.1 two-component response regulator [YclK] VFG1702 Protein 4e-41 45
yclJ YP_008419803.1 two-component response regulator [YclK] VFG1389 Protein 2e-31 43