|
Name : BASU_3366 (BASU_3366) Accession : YP_008422771.1 Strain : Bacillus amyloliquefaciens UCMB5113 Genome accession: NC_022081 Putative virulence/resistance : Virulence Product : Putative transcription regulator HTH, Cro/C1-type DNA-binding Function : - COG functional category : - COG ID : - EC number : - Position : 3553312 - 3553515 bp Length : 204 bp Strand : + Note : Evidence 3:Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr:putative regulator DNA sequence : GTGGATAACAATATTAAAAAACTTAGAACAGCAGCTGATATTTCACAAAATGATCTGGCTAAGCTCTGCAATGTGACCAG GCAAACCATCAATGCAATTGAAAATAATAAATATGATCCAACTTTAAGTCTGGCTTTTTCGATAGCTCACGCATTAAATA CGGGAATAGATAAAGTATTCAACTATAACGCCAAAAAAAAGTAA Protein sequence : MDNNIKKLRTAADISQNDLAKLCNVTRQTINAIENNKYDPTLSLAFSIAHALNTGIDKVFNYNAKKK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SH2314 | YP_254229.1 | hypothetical protein | Not tested | ¥ðSh1 | Protein | 2e-09 | 55 |
| EF0524 | NP_814301.1 | Cro/CI family transcriptional regulator | Not tested | Not named | Protein | 3e-09 | 49 |
| ef0042 | AAM75247.1 | EF0042 | Virulence | Not named | Protein | 2e-09 | 49 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| BASU_3366 | YP_008422771.1 | Putative transcription regulator HTH, Cro/C1-type DNA-binding | VFG2175 | Protein | 1e-09 | 49 |
| BASU_3366 | YP_008422771.1 | Putative transcription regulator HTH, Cro/C1-type DNA-binding | VFG2168 | Protein | 1e-09 | 49 |
