Gene Information

Name : ebrA (BASU_1673)
Accession : YP_008421098.1
Strain : Bacillus amyloliquefaciens UCMB5113
Genome accession: NC_022081
Putative virulence/resistance : Resistance
Product : small multidrug resistance efflux transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1782204 - 1782536 bp
Length : 333 bp
Strand : -
Note : Evidence 2a:Function of homologous gene experimentally demonstrated in an other organism; PubMedId:10735876, 11104814, 17516673; Product type t:transporter

DNA sequence :
ATGAGAGGGGGATTTGATATGATTCTGGGTTATATCTTCCTCACAATTGCTATTTTATCAGAGTCAATCGGCGCGGCCAT
GCTGAAGGTCTCCCGCGGATTTACGCGGTTTTTGCCGAGCGCGCTTGTAGTGGCAGGCTATTCATTGGCCTTTTATATGC
TTTCACTGACACTGAATCTCATTCCGCTTAGCTTATCCTATGCAACATGGAGCGGAGCCGGAACGGTGCTCGCATCCATT
ATCGGAGCGAAATGGTTTCATGAAAAACTGGACAAGCAGGCCGTCATCGGACTCTTTTTCTTATTGGCCGGTGTCATTTT
GATGAATTGGTAG

Protein sequence :
MRGGFDMILGYIFLTIAILSESIGAAMLKVSRGFTRFLPSALVVAGYSLAFYMLSLTLNLIPLSLSYATWSGAGTVLASI
IGAKWFHEKLDKQAVIGLFFLLAGVILMNW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-08 44
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-08 44
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-08 44
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 3e-08 44
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-08 44
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 3e-08 44
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-08 44
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-08 44
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-08 44
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-08 44
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-08 44
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-08 44
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-08 44
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-08 44
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-08 44
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 3e-08 44
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-08 44
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-08 44
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-08 44
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-08 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0139 Protein 2e-24 72
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0324 Protein 3e-11 50
ebrA YP_008421098.1 small multidrug resistance efflux transporter NC_010410.6003348.p0 Protein 2e-13 48
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0002 Protein 2e-13 48
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0140 Protein 1e-08 46
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0322 Protein 5e-10 45
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0377 Protein 7e-12 45
ebrA YP_008421098.1 small multidrug resistance efflux transporter NC_002695.1.913273.p Protein 5e-10 45
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0150 Protein 6e-10 44
ebrA YP_008421098.1 small multidrug resistance efflux transporter CP001138.1.gene1489. Protein 9e-11 44
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0323 Protein 9e-09 44
ebrA YP_008421098.1 small multidrug resistance efflux transporter CP004022.1.gene1549. Protein 3e-11 42
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0329 Protein 1e-08 42
ebrA YP_008421098.1 small multidrug resistance efflux transporter BAC0325 Protein 7e-07 41