|
Name : fliQ (BASU_1576) Accession : YP_008421002.1 Strain : Bacillus amyloliquefaciens UCMB5113 Genome accession: NC_022081 Putative virulence/resistance : Virulence Product : component of the flagellar export machinery Function : - COG functional category : - COG ID : - EC number : - Position : 1622092 - 1622370 bp Length : 279 bp Strand : + Note : Evidence 2a:Function of homologous gene experimentally demonstrated in an other organism; PubMedId:10234819, 15516571; Product type t:transporter DNA sequence : GTGCTAATTGTGAGTTCAGAATTTGTAATTTCCATGGCGGAAAAAGCCGTATATGTAACACTAATGATCAGCGGGCCGCT GCTTGCGATCGCGCTGATTGTCGGTTTGCTCGTCAGTATCTTTCAAGCGACAACTCAAATCCAGGAACAGACGCTTGCGT TCATTCCGAAAATCGTGGCGGTGATGCTTGGACTGATCTTTTTCGGTCCTTGGATGCTGTCGACGATTCTTTCGTTCACA ACTGATCTGTTTTCTCATCTGAACCGATTTGCAGGGTAG Protein sequence : MLIVSSEFVISMAEKAVYVTLMISGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVMLGLIFFGPWMLSTILSFT TDLFSHLNRFAG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ysaS | AAS66847.1 | YsaS | Not tested | SSR-1 | Protein | 0.012 | 42 |
| spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 3e-04 | 42 |
| spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 3e-04 | 42 |
| spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 3e-04 | 42 |
| spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 3e-04 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| fliQ | YP_008421002.1 | component of the flagellar export machinery | VFG2495 | Protein | 2e-08 | 50 |
| fliQ | YP_008421002.1 | component of the flagellar export machinery | VFG2015 | Protein | 2e-07 | 43 |
| fliQ | YP_008421002.1 | component of the flagellar export machinery | VFG0550 | Protein | 9e-05 | 42 |
