Gene Information

Name : N559_5135 (N559_5135)
Accession : YP_008414916.1
Strain :
Genome accession: NC_022078
Putative virulence/resistance : Unknown
Product : ISEc8 transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2261 - 2668 bp
Length : 408 bp
Strand : -
Note : -

DNA sequence :
GTGTGTGGTGAAGTAGTCTGGCGAAGTCATAAGGATCATCACAGGACAGATAAAGGAAGTGATAACCACCTGCCAACAGG
CACCAAAATCTGGCTGGTTGCCGGTATCACCGACATGCGCAACGGCTTCAATGGTCTCGCCGCAAAGGTGCAGACGATGC
TGAAAGATGACCCGATGTCCGGCCATGTCTTCATCTTCCGGGGCCGCAGCGGCAGTAAGGTCAAACTGCTGTGGTCCACC
GGCGACGGGCTGTGCCTGCTGACCAAACGGCTGGAACGCGGCCGCTTCGCCTGGCCCTCTGCCCGCGATGGCAAAGTGTT
CCTGACCCCGGCGCAGCTGGCAATGCTTCTGGAAGGCATCGACTGGCGGCAGCCTAAAAGACTGCTTACGTCCCTGACCA
TGTTGTAG

Protein sequence :
MCGEVVWRSHKDHHRTDKGSDNHLPTGTKIWLVAGITDMRNGFNGLAAKVQTMLKDDPMSGHVFIFRGRSGSKVKLLWST
GDGLCLLTKRLERGRFAWPSARDGKVFLTPAQLAMLLEGIDWRQPKRLLTSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-46 96
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-46 96
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-46 96
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-46 96
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-46 96
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-46 96
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-46 96
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-46 96
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-46 96
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-46 96
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-45 96
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-45 96
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-46 94
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-38 76
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-38 76
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 7e-38 75
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 4e-36 74
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 4e-36 74
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-28 68
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-33 65
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-33 65
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-34 64
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-34 64
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-34 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
N559_5135 YP_008414916.1 ISEc8 transposase VFG0792 Protein 1e-46 96
N559_5135 YP_008414916.1 ISEc8 transposase VFG1698 Protein 3e-47 96
N559_5135 YP_008414916.1 ISEc8 transposase VFG1709 Protein 1e-46 96
N559_5135 YP_008414916.1 ISEc8 transposase VFG1052 Protein 2e-46 94
N559_5135 YP_008414916.1 ISEc8 transposase VFG1665 Protein 3e-38 75
N559_5135 YP_008414916.1 ISEc8 transposase VFG1737 Protein 2e-34 63