|
Name : RBAU_3590 (RBAU_3590) Accession : YP_008414563.1 Strain : Bacillus amyloliquefaciens UCMB-5033 Genome accession: NC_022075 Putative virulence/resistance : Virulence Product : Putative transcription regulator HTH, Cro/C1-type DNA-binding Function : - COG functional category : - COG ID : - EC number : - Position : 3722063 - 3722266 bp Length : 204 bp Strand : + Note : Evidence 3:Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr:putative regulator DNA sequence : GTGGATAACAATATTAAAAAACTTAGAACAGCAGCTGATATTTCACAAAATGATCTGGCTAAGCTCTGCAATGTGACCAG GCAAACCATCAATGCAATTGAAAATAATAAATATGACCCGACTTTAAGTCTGGCTTTTTCGATAGCTCACGCATTAAATA CGGGAATAGATAAAGTATTCAACTATAACGCCAAAAAAAAGTAA Protein sequence : MDNNIKKLRTAADISQNDLAKLCNVTRQTINAIENNKYDPTLSLAFSIAHALNTGIDKVFNYNAKKK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SH2314 | YP_254229.1 | hypothetical protein | Not tested | ¥ðSh1 | Protein | 2e-09 | 55 |
| EF0524 | NP_814301.1 | Cro/CI family transcriptional regulator | Not tested | Not named | Protein | 3e-09 | 49 |
| ef0042 | AAM75247.1 | EF0042 | Virulence | Not named | Protein | 2e-09 | 49 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| RBAU_3590 | YP_008414563.1 | Putative transcription regulator HTH, Cro/C1-type DNA-binding | VFG2168 | Protein | 1e-09 | 49 |
| RBAU_3590 | YP_008414563.1 | Putative transcription regulator HTH, Cro/C1-type DNA-binding | VFG2175 | Protein | 1e-09 | 49 |
