Gene Information

Name : fliQ (RBAU_1597)
Accession : YP_008412592.1
Strain : Bacillus amyloliquefaciens UCMB-5033
Genome accession: NC_022075
Putative virulence/resistance : Virulence
Product : component of the flagellar export machinery
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1660089 - 1660367 bp
Length : 279 bp
Strand : +
Note : Evidence 2a:Function of homologous gene experimentally demonstrated in an other organism; PubMedId:10234819, 15516571; Product type t:transporter

DNA sequence :
GTGCTAATTGTGAGTTCAGAATTTGTAATTTCCATGGCGGAAAAAGCCGTATATGTAACACTAATGATCAGCGGGCCGCT
GCTTGCGATCGCGCTGATTGTCGGTTTGCTCGTCAGTATCTTTCAAGCGACAACTCAAATCCAGGAACAGACGCTTGCGT
TCATTCCGAAAATCGTGGCAGTGATGCTTGGACTGATCTTTTTCGGTCCTTGGATGCTGTCGACGATTCTTTCGTTCACA
ACTGATCTGTTTTCTCATCTGAACCGATTTGCAGGGTAG

Protein sequence :
MLIVSSEFVISMAEKAVYVTLMISGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVMLGLIFFGPWMLSTILSFT
TDLFSHLNRFAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 0.012 42
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 3e-04 42
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 3e-04 42
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 3e-04 42
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 3e-04 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_008412592.1 component of the flagellar export machinery VFG2495 Protein 2e-08 50
fliQ YP_008412592.1 component of the flagellar export machinery VFG2015 Protein 2e-07 43
fliQ YP_008412592.1 component of the flagellar export machinery VFG0550 Protein 9e-05 42