Gene Information

Name : mtrA (cgp_0862)
Accession : YP_008400880.1
Strain : Corynebacterium glutamicum MB001
Genome accession: NC_022040
Putative virulence/resistance : Virulence
Product : two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation
Function : -
COG functional category : -
COG ID : -
EC number : 3.1.1.61
Position : 793626 - 794306 bp
Length : 681 bp
Strand : +
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGTCACAGAAAATTCTCGTGGTTGATGATGATCCCGCCATCTCCGAGATGCTCACCATCGTGCTCAGCGCAGAAGGCTT
TGACACCGTAGCTGTCACCGACGGCGCACTCGCCGTGGAAACCGCCTCCCGGGAACAACCGGATCTGATTTTGCTCGACT
TGATGCTTCCAGGCATGAACGGCATCGACATTTGTCGCCTCATCCGCCAAGAATCCTCCGTACCCATCATCATGCTCACC
GCCAAAACCGACACCGTTGATGTGGTGCTCGGTTTGGAATCCGGTGCAGACGATTACGTGAACAAGCCTTTCAAAGCGAA
AGAACTTGTCGCCCGCATCCGTGCCCGCCTCCGCGCAACCGTGGACGAGCCCAGCGAAATCATCGAAGTCGGCGATCTGT
CCATCGACGTCCCAGCACACACCGTCAAACGAAACGGCGCTGAGATTTCCTTGACCCCACTCGAATTCGACCTCCTGCTG
GAACTCGCCCGCAAACCACAGCAAGTATTCACCCGTGAAGAATTGCTGGGCAAAGTGTGGGGCTACCGCCACGCATCCGA
CACTCGACTGGTCAACGTTCACGTTCAGCGTCTGCGCGCCAAGATTGAAAAAGATCCAGAAAATCCGCAGATCGTCCTCA
CCGTCCGCGGTGTTGGCTACAAAACTGGCCACAACGATTAA

Protein sequence :
MSQKILVVDDDPAISEMLTIVLSAEGFDTVAVTDGALAVETASREQPDLILLDLMLPGMNGIDICRLIRQESSVPIIMLT
AKTDTVDVVLGLESGADDYVNKPFKAKELVARIRARLRATVDEPSEIIEVGDLSIDVPAHTVKRNGAEISLTPLEFDLLL
ELARKPQQVFTREELLGKVWGYRHASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKTGHND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation AE000516.2.gene3505. Protein 9e-69 73
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_002952.2859905.p0 Protein 3e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_002951.3237708.p0 Protein 4e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_002758.1121668.p0 Protein 4e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_003923.1003749.p0 Protein 3e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_009641.5332272.p0 Protein 4e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_013450.8614421.p0 Protein 4e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_007793.3914279.p0 Protein 4e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_012469.1.7685629. Protein 1e-42 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_007622.3794472.p0 Protein 3e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_002745.1124361.p0 Protein 4e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_009782.5559369.p0 Protein 4e-43 48
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_003923.1003417.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_013450.8614146.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_002951.3238224.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_007793.3914065.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_002758.1121390.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_010079.5776364.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_002952.2859858.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_007622.3794948.p0 Protein 3e-37 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation HE999704.1.gene2815. Protein 3e-40 46
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation NC_012469.1.7686381. Protein 5e-39 45
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation BAC0111 Protein 1e-27 43
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation AE015929.1.gene1106. Protein 4e-31 42
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation AE016830.1.gene1681. Protein 6e-38 42
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation BAC0125 Protein 3e-30 42
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation CP000675.2.gene1535. Protein 4e-33 41
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation AF155139.2.orf0.gene Protein 6e-34 41
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation BAC0197 Protein 8e-29 41
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation CP001918.1.gene5135. Protein 3e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation VFG1563 Protein 6e-37 43
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation VFG1702 Protein 4e-37 43
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation VFG1389 Protein 9e-28 42
mtrA YP_008400880.1 two-component system, transcriptional response regulator involved in cell wall metabolism and osmoregulation VFG1390 Protein 9e-31 41