Gene Information

Name : spaP (BB2000_2688)
Accession : YP_008399203.1
Strain : Proteus mirabilis BB2000
Genome accession: NC_022000
Putative virulence/resistance : Virulence
Product : surface presentation of antigens protein SpaP
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2930622 - 2931281 bp
Length : 660 bp
Strand : -
Note : matching_protein_id: YP_002152389.1; matching_locus_tag: PMI2688

DNA sequence :
ATGGAAAGCTCAACACAATTAATCTTGATCCTAGCTCTTGCCACATTGGCTCCTTTTATTATTGCTGCAGGAACTTGTTA
TTTAAAGTTTTCTATCGTTTTAGTCATGACTCGTAATGCATTAGGTGTGCAGCAAGTTCCTTCTAATATGGTACTTAATG
CTATCGCTTTAATGATGGCTCTTTTTGTTATGACACCAATTACTAAAAATATTTGTTACTATTTTATTGAAAATAAAGTG
GATATGTCATCTCCAGATGCGATCGAGTCATTTTCAAATGAGGCGTTAGGCGATTATAAAAAATACCTATATCATTACTC
AGATCCTGATTTATTAGCTTTTTTTGAACAAGCGCAAGAGAATAGACCAAATAGTGATGGTGATAAAGAAAATATAGAAA
ATTCACTCTTATCATTATTACCGGCATATGCACTTAGTGAGATAAAATCTGCTTTTATTATAGGTTTCTATCTTTATTTA
CCTTTTATTGTTATTGACTTAGTTGTCTCATGCATTTTATTAGCATTAGGTATGATGATGATGAGCCCTATTACATTATC
TGTACCTTTAAAACTTATTTTATTTATCGCCATGGATGGTTGGGGACTGTTATCTAAGGGACTCATTAATCAATATCTTG
ATTTGATGGCGGTGAACTAG

Protein sequence :
MESSTQLILILALATLAPFIIAAGTCYLKFSIVLVMTRNALGVQQVPSNMVLNAIALMMALFVMTPITKNICYYFIENKV
DMSSPDAIESFSNEALGDYKKYLYHYSDPDLLAFFEQAQENRPNSDGDKENIENSLLSLLPAYALSEIKSAFIIGFYLYL
PFIVIDLVVSCILLALGMMMMSPITLSVPLKLILFIAMDGWGLLSKGLINQYLDLMAVN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 3e-50 57
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 7e-43 55
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 7e-43 55
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 7e-43 55
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 7e-43 55
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 1e-48 55
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 1e-46 54
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 2e-48 53
hrcR AAB06005.2 HrcR Virulence Hrp PAI Protein 5e-32 44
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 4e-30 43
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 4e-30 43
escR AAC31528.1 L0049 Virulence LEE Protein 3e-30 43
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-27 43
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 4e-30 43
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 3e-30 43
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-27 43
escR AAC38369.1 EscR Virulence LEE Protein 2e-29 43
hrcR ABQ88359.1 HrcR Virulence Hrp PAI Protein 4e-24 42
hrpW AAB05075.1 HrpW Virulence Hrp PAI Protein 4e-24 42
escR AAL57527.1 EscR Virulence LEE Protein 3e-30 42
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 5e-30 42
escR CAC81847.1 EscR protein Virulence LEE II Protein 3e-30 42
escR CAI43889.1 EscR protein Virulence LEE Protein 3e-30 42
escR AAK26700.1 EscR Virulence LEE Protein 3e-30 42
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 5e-30 42
unnamed AAL06354.1 EscR Virulence LEE Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaP YP_008399203.1 surface presentation of antigens protein SpaP VFG1773 Protein 5e-54 61
spaP YP_008399203.1 surface presentation of antigens protein SpaP VFG2455 Protein 1e-52 60
spaP YP_008399203.1 surface presentation of antigens protein SpaP VFG1012 Protein 4e-47 59
spaP YP_008399203.1 surface presentation of antigens protein SpaP VFG0551 Protein 3e-43 55
spaP YP_008399203.1 surface presentation of antigens protein SpaP VFG0715 Protein 9e-30 43
spaP YP_008399203.1 surface presentation of antigens protein SpaP VFG0827 Protein 1e-30 43
spaP YP_008399203.1 surface presentation of antigens protein SpaP VFG0044 Protein 8e-31 41