Gene Information

Name : pqrA (BB2000_1089)
Accession : YP_008397644.1
Strain : Proteus mirabilis BB2000
Genome accession: NC_022000
Putative virulence/resistance : Resistance
Product : AraC-family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1208910 - 1209278 bp
Length : 369 bp
Strand : -
Note : matching_protein_id: YP_002150802.1; matching_locus_tag: PMI1052

DNA sequence :
ATGGCTGAAAATGTCGTTAATGATATTCTGAAATGGTTAGAAACTCAGTTACAACGTAATGAGGGTATAAAGATTGATAC
GATTGCAAATAAAAGTGGCTACTCGAAGTGGCATTTGCAACGTATTTTTAAAGATTTTAAAGGTTGCACATTAGGCGAAT
ATGTACGTAAACGTCGCTTATTGGAAGCAGCAAAGTCTTTACAAGAAAAAGACATGTCCATTTTAGATATTGCTTTGATG
TATGGCTTTAGTTCCCAAGCAACATTTACTCGTATCTTTAAAAAACACTTCAACACTACACCAGCTAAATTTAGAGAACA
TGGTGAGTTACCAGATACACGTCGTTTTATGTCATGTGAAAATAGCTAA

Protein sequence :
MAENVVNDILKWLETQLQRNEGIKIDTIANKSGYSKWHLQRIFKDFKGCTLGEYVRKRRLLEAAKSLQEKDMSILDIALM
YGFSSQATFTRIFKKHFNTTPAKFREHGELPDTRRFMSCENS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-19 47
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-19 47
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 4e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pqrA YP_008397644.1 AraC-family transcriptional regulator CP001138.1.gene612.p Protein 1e-23 48
pqrA YP_008397644.1 AraC-family transcriptional regulator NC_010558.1.6276025. Protein 8e-20 47
pqrA YP_008397644.1 AraC-family transcriptional regulator CP001918.1.gene2033. Protein 1e-21 42
pqrA YP_008397644.1 AraC-family transcriptional regulator CP001138.1.gene4488. Protein 1e-21 41
pqrA YP_008397644.1 AraC-family transcriptional regulator CP000034.1.gene4505. Protein 6e-22 41
pqrA YP_008397644.1 AraC-family transcriptional regulator NC_002695.1.914293.p Protein 3e-22 41
pqrA YP_008397644.1 AraC-family transcriptional regulator BAC0371 Protein 3e-22 41
pqrA YP_008397644.1 AraC-family transcriptional regulator CP001918.1.gene327.p Protein 2e-22 41
pqrA YP_008397644.1 AraC-family transcriptional regulator CP000647.1.gene1624. Protein 5e-22 41
pqrA YP_008397644.1 AraC-family transcriptional regulator BAC0560 Protein 2e-21 41
pqrA YP_008397644.1 AraC-family transcriptional regulator CP001138.1.gene1637. Protein 1e-21 41
pqrA YP_008397644.1 AraC-family transcriptional regulator NC_002695.1.917339.p Protein 2e-21 41
pqrA YP_008397644.1 AraC-family transcriptional regulator CP000034.1.gene1596. Protein 2e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pqrA YP_008397644.1 AraC-family transcriptional regulator VFG1038 Protein 8e-20 47
pqrA YP_008397644.1 AraC-family transcriptional regulator VFG0585 Protein 1e-21 41