Gene Information

Name : APA386B_486 (APA386B_486)
Accession : YP_008391321.1
Strain : Acetobacter pasteurianus 386B
Genome accession: NC_021991
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 472035 - 472382 bp
Length : 348 bp
Strand : +
Note : Transposase (putative), IS66 Orf2 like, IS66 Orf2 like protein

DNA sequence :
ATGATTGGCGTGGGCAACGGTGTGCGCGTCTATCTGGCCTGCGGGGTTACGGATATGCGCAAGGGGATATCGGGTCTGGC
TGCACTGGCACAGGACGTGCTGCGTCAGAACCCGACATCGGGAGCGCTCTTTGCCTTTCGTGGTCGCCGTGGGGACAGGA
TCAAGCTTCTGATGTGGGACGGTCAGGGGTTCTGCCTTTATTACAAGGTGCTTGAGAAAGGACGTTTTCCATGGCCCTCG
CCGGCAGATGGCGTTGCACGCCTGACAGCCGCACAGATGGCCATGCTGTGGGAAGGCATGGAGTGGAGACGACCTTCCTG
GTCTGCGCCACCGTCTCGCGTGGCCTGA

Protein sequence :
MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALFAFRGRRGDRIKLLMWDGQGFCLYYKVLEKGRFPWPS
PADGVARLTAAQMAMLWEGMEWRRPSWSAPPSRVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-21 53
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-22 52
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-22 52
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-22 52
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-22 52
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-22 52
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-22 52
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-22 52
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-22 52
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-21 52
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-22 52
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-22 52
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-21 52
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-22 52
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-22 52
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-22 52
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-16 51
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-25 51
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-25 51
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-22 51
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-24 50
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-21 50
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-21 50
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 7e-21 45
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 7e-21 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
APA386B_486 YP_008391321.1 IS66 Orf2 family protein VFG0792 Protein 1e-22 52
APA386B_486 YP_008391321.1 IS66 Orf2 family protein VFG1698 Protein 9e-23 52
APA386B_486 YP_008391321.1 IS66 Orf2 family protein VFG1709 Protein 1e-22 52
APA386B_486 YP_008391321.1 IS66 Orf2 family protein VFG1737 Protein 2e-22 52
APA386B_486 YP_008391321.1 IS66 Orf2 family protein VFG1517 Protein 1e-16 51
APA386B_486 YP_008391321.1 IS66 Orf2 family protein VFG1052 Protein 2e-22 51
APA386B_486 YP_008391321.1 IS66 Orf2 family protein VFG1665 Protein 7e-25 50