Gene Information

Name : B446_19735 (B446_19735)
Accession : YP_008387570.1
Strain : Streptomyces collinus Tu 365
Genome accession: NC_021985
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4541526 - 4542293 bp
Length : 768 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCAGCAGCCGTACGCATCCCCGCACACCGGACCGGAGCCCGGGCCGCGGCCGGGCGCGCGGGGCCGGGTCCTCGTCGT
GGACGACGACCCGACCGTCGCCGAGGTCGTCGCCGGGTACCTGGACCGCGCCGGATACGCCGTGGACCGGGCCGCCGACG
GCCCGGCCGCCCTGGAGCGCGCCGCCGCGCACCGGCCCGACCTGGTGGTGCTGGACCTGATGCTGCCCGGCATGGACGGC
CTGGAGGTGTGCCGGCGGCTGCGCGAGCACGGGCCGGTGCCGGTCGTCATGCTCACCGCGCGCGGCGACGAGGAGGACCG
CGTCCTCGGTCTCGAGGTCGGCGCCGACGACTACGTCACCAAGCCGTTCAGCCCGCGCGAGCTGGTGCTGCGGGTGGACT
CGGTGCTGCGCCGGGCCCGGCCCGCCGCGCCGCGGGACCCGGGGGGCCCGCACGGCCCGTGCGGCGCGGCCGGTCTGAGT
ATCGACCCGGCCGCCCGCCGCGCCACCAAGAACGGCACCGAACTGGCCCTCACACTGCGCGAGTTCGACCTGCTCGCGTT
CCTGTTGCGGCATCCTGGGCGGGCGTTCGCCCGGGAGGAGCTGATGCGGGAGGTGTGGGGCTGGGACTTCGGCGACCTGT
CGACCGTCACCGTCCATGTGCGCCGGCTGCGCGGCAAGGTCGAGGACGACCCGGCGCGGCCGCGGCTCATCCGGACGGTG
TGGGGCGTCGGCTACCGCTTCGACGCCACCGGGACGGAGGCGGACTGA

Protein sequence :
MQQPYASPHTGPEPGPRPGARGRVLVVDDDPTVAEVVAGYLDRAGYAVDRAADGPAALERAAAHRPDLVVLDLMLPGMDG
LEVCRRLREHGPVPVVMLTARGDEEDRVLGLEVGADDYVTKPFSPRELVLRVDSVLRRARPAAPRDPGGPHGPCGAAGLS
IDPAARRATKNGTELALTLREFDLLAFLLRHPGRAFAREELMREVWGWDFGDLSTVTVHVRRLRGKVEDDPARPRLIRTV
WGVGYRFDATGTEAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-28 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_19735 YP_008387570.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-43 48
B446_19735 YP_008387570.1 two-component system response regulator AE000516.2.gene3505. Protein 3e-40 48
B446_19735 YP_008387570.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-43 45
B446_19735 YP_008387570.1 two-component system response regulator NC_012469.1.7686381. Protein 2e-41 42
B446_19735 YP_008387570.1 two-component system response regulator BAC0197 Protein 3e-30 41
B446_19735 YP_008387570.1 two-component system response regulator BAC0125 Protein 3e-30 41
B446_19735 YP_008387570.1 two-component system response regulator BAC0083 Protein 1e-32 41
B446_19735 YP_008387570.1 two-component system response regulator CP000034.1.gene3671. Protein 3e-41 41
B446_19735 YP_008387570.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_19735 YP_008387570.1 two-component system response regulator VFG1389 Protein 3e-29 44
B446_19735 YP_008387570.1 two-component system response regulator VFG1390 Protein 3e-33 42
B446_19735 YP_008387570.1 two-component system response regulator VFG0596 Protein 2e-28 41
B446_19735 YP_008387570.1 two-component system response regulator VFG1563 Protein 2e-36 41
B446_19735 YP_008387570.1 two-component system response regulator VFG1702 Protein 4e-36 41