Gene Information

Name : B446_17560 (B446_17560)
Accession : YP_008387139.1
Strain : Streptomyces collinus Tu 365
Genome accession: NC_021985
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4055388 - 4055963 bp
Length : 576 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGTGGCAACGTCTCGCTCACCAAGGAGGCTCCGGGCCTGACCGCCGTCACCGTGGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACGGACTTCGACCTGGACGCCTCCGCCATCGCGGTGAACACGCAGGGCAAGG
TCTACTCCGACGCCCACTTCGTGTTCTTCAACAACAAGCAGACCCCGGACAACTCGATCGTCCACACCGGTGACAACCGC
ACCGGCGAGGGCGCGGGCGACGACGAGGCGATCAACGTCAACCTGGCCGCCCTCCCGGCCGACATCGACAAGATCGTCTT
CCCGGTCTCCATCTACGACGCCGAGAACCGCGGCCAGAACTTCGGCCAGGTCCGCAACGCCTACATCCGCATCGTCAACC
AGGCGGGCGGCGCCGAGATCGCGCGCTACGACCTCTCGGAGGACGCGGCCACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGTTACGCCTCCGGCCTGGTCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNTQGKVYSDAHFVFFNNKQTPDNSIVHTGDNR
TGEGAGDDEAINVNLAALPADIDKIVFPVSIYDAENRGQNFGQVRNAYIRIVNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 61
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-58 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 8e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_17560 YP_008387139.1 stress protein BAC0390 Protein 6e-59 62
B446_17560 YP_008387139.1 stress protein BAC0389 Protein 9e-58 61