Gene Information

Name : B446_15650 (B446_15650)
Accession : YP_008386759.1
Strain : Streptomyces collinus Tu 365
Genome accession: NC_021985
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3622190 - 3622867 bp
Length : 678 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGGGACGAGTCCTTGTCGTCGACGACGACACCGCACTGGCCGAGATGCTCGGCATCGTGTTGCGTGGTGAAGGTTT
TGAGCCGTCTTTCGTGGCCGACGGCGACAAGGCGCTGGCCGCTTTCCGTGAGGCCAAGCCCGACCTGGTGCTGCTCGACC
TGATGCTGCCCGGCCGGGACGGCATCGAGGTGTGCCGCCTGATCAGGGCGGAGTCCGGCGTACCGATCGTGATGCTCACG
GCCAAGAGCGACACCGTCGACGTCGTCGTGGGCCTGGAGTCCGGGGCCGACGACTACATCGTGAAGCCGTTCAAGCCGAA
GGAGCTGGTGGCCCGCATCCGGGCGCGGCTCAGGAGGTCGGAGGAGCCGGCGCCGGAGCAGCTCACCATCGGTGACCTGG
TGATCGACGTGGCCGGGCACTCCGTGAAGCGGGACGGGCAGTCGATCGCGCTCACCCCGCTGGAGTTCGACCTGCTGGTG
GCGCTGGCCCGCAAGCCGTGGCAGGTGTTCACCCGCGAGGTGCTCCTGGAGCAGGTGTGGGGCTACCGGCACGCCGCCGA
CACCCGTCTGGTCAACGTGCACGTCCAGCGGCTGCGTTCCAAGGTCGAGAAGGACCCGGAGCGGCCGGAGATCGTGGTGA
CCGTCCGCGGTGTCGGGTACAAGGCGGGACCGAGCTGA

Protein sequence :
MKGRVLVVDDDTALAEMLGIVLRGEGFEPSFVADGDKALAAFREAKPDLVLLDLMLPGRDGIEVCRLIRAESGVPIVMLT
AKSDTVDVVVGLESGADDYIVKPFKPKELVARIRARLRRSEEPAPEQLTIGDLVIDVAGHSVKRDGQSIALTPLEFDLLV
ALARKPWQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVEKDPERPEIVVTVRGVGYKAGPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_15650 YP_008386759.1 two-component system response regulator AE000516.2.gene3505. Protein 8e-80 76
B446_15650 YP_008386759.1 two-component system response regulator BAC0125 Protein 6e-34 46
B446_15650 YP_008386759.1 two-component system response regulator NC_002952.2859905.p0 Protein 4e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_009782.5559369.p0 Protein 6e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_002951.3237708.p0 Protein 6e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_003923.1003749.p0 Protein 5e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_002758.1121668.p0 Protein 6e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_007622.3794472.p0 Protein 4e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_009641.5332272.p0 Protein 6e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_013450.8614421.p0 Protein 6e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_007793.3914279.p0 Protein 6e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_002745.1124361.p0 Protein 6e-46 46
B446_15650 YP_008386759.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-45 46
B446_15650 YP_008386759.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-42 45
B446_15650 YP_008386759.1 two-component system response regulator NC_012469.1.7686381. Protein 6e-42 44
B446_15650 YP_008386759.1 two-component system response regulator NC_002952.2859858.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator NC_007622.3794948.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator NC_003923.1003417.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator NC_013450.8614146.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator NC_002951.3238224.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator NC_007793.3914065.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator NC_002758.1121390.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator NC_010079.5776364.p0 Protein 4e-40 43
B446_15650 YP_008386759.1 two-component system response regulator AE015929.1.gene1106. Protein 7e-36 43
B446_15650 YP_008386759.1 two-component system response regulator CP001138.1.gene2239. Protein 3e-40 43
B446_15650 YP_008386759.1 two-component system response regulator BAC0596 Protein 3e-40 43
B446_15650 YP_008386759.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-34 42
B446_15650 YP_008386759.1 two-component system response regulator AE016830.1.gene1681. Protein 4e-41 42
B446_15650 YP_008386759.1 two-component system response regulator BAC0039 Protein 2e-40 42
B446_15650 YP_008386759.1 two-component system response regulator CP001918.1.gene3444. Protein 1e-39 42
B446_15650 YP_008386759.1 two-component system response regulator CP000034.1.gene2186. Protein 2e-40 42
B446_15650 YP_008386759.1 two-component system response regulator NC_002695.1.916589.p Protein 2e-40 42
B446_15650 YP_008386759.1 two-component system response regulator AF155139.2.orf0.gene Protein 4e-35 41
B446_15650 YP_008386759.1 two-component system response regulator FJ349556.1.orf0.gene Protein 2e-36 41
B446_15650 YP_008386759.1 two-component system response regulator BAC0197 Protein 5e-32 41
B446_15650 YP_008386759.1 two-component system response regulator CP000647.1.gene2531. Protein 6e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_15650 YP_008386759.1 two-component system response regulator VFG1389 Protein 4e-32 45
B446_15650 YP_008386759.1 two-component system response regulator VFG1390 Protein 2e-35 42
B446_15650 YP_008386759.1 two-component system response regulator VFG1702 Protein 8e-38 41