Gene Information

Name : B446_14780 (B446_14780)
Accession : YP_008386585.1
Strain : Streptomyces collinus Tu 365
Genome accession: NC_021985
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3419585 - 3420295 bp
Length : 711 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGCTCGTGGTCGAGGACGACCAGTTCGTACGCTCGGCGCTCATCCGGCATCTGACCGACGCCGCGCACACCGTGCGCAG
CGTCGGCACCGCGCTGGAGGCGCTGCGCGAGGCCGCCCACTTCCGGTTCGACGTGGTCATCCTGGACCTCGGACTGCCCG
ACCTGGACGGCTCCGAGGCGCTGAAGATGCTCCGCGGCATCACGGACGTACCGGTGATCATCGCCACCGCGCGGGACGAC
GAGACGGAGATCGTCCGGCTGCTCAACGCCGGGGCGGACGACTACCTGACCAAGCCGTTCTCGGTCGAGCACCTCTCGGC
GCGGATCGCGGCCGTGCTGCGCCGGGCCCGCTCGGCCGGCGGCGAGCCCCCGCCCACGCCCGTCATCCGCGTCGGCGGGC
TGACCGTGGACCCGCTGCGCCGCCAGGCCGAACTGGACGGCGTACGGCTCGACCTGACGCGCCGCGAGTTCGACCTGCTC
GCCTTCCTCGCCGGCCGTCCCGGTGTCGTCGTCCCGCGCCGGGAACTGCTCGCCGAGGTCTGGCAGCAGTCCTACGGCGA
CGACCAGACCATCGACGTCCATCTGTCCTGGCTGCGCCGGAAGCTCGGCGAGACGGCCGCCCGGCCGCGCTATCTGCACA
CGCTCCGGGGGGTCGGCGTGAAGCTCGAACCGCCCGTTCCCGCCGACGGGGGAGGGGAGCCGCCGAGATGA

Protein sequence :
MLVVEDDQFVRSALIRHLTDAAHTVRSVGTALEALREAAHFRFDVVILDLGLPDLDGSEALKMLRGITDVPVIIATARDD
ETEIVRLLNAGADDYLTKPFSVEHLSARIAAVLRRARSAGGEPPPTPVIRVGGLTVDPLRRQAELDGVRLDLTRREFDLL
AFLAGRPGVVVPRRELLAEVWQQSYGDDQTIDVHLSWLRRKLGETAARPRYLHTLRGVGVKLEPPVPADGGGEPPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-27 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_14780 YP_008386585.1 two-component system response regulator CP001918.1.gene5135. Protein 4e-21 43
B446_14780 YP_008386585.1 two-component system response regulator BAC0533 Protein 3e-21 43
B446_14780 YP_008386585.1 two-component system response regulator CP000647.1.gene4257. Protein 3e-21 43
B446_14780 YP_008386585.1 two-component system response regulator CP001138.1.gene4273. Protein 2e-21 43
B446_14780 YP_008386585.1 two-component system response regulator CP004022.1.gene3215. Protein 1e-21 42
B446_14780 YP_008386585.1 two-component system response regulator CP000034.1.gene3834. Protein 8e-21 42
B446_14780 YP_008386585.1 two-component system response regulator NC_002695.1.915041.p Protein 8e-21 42
B446_14780 YP_008386585.1 two-component system response regulator HE999704.1.gene2815. Protein 5e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_14780 YP_008386585.1 two-component system response regulator VFG1389 Protein 2e-31 43
B446_14780 YP_008386585.1 two-component system response regulator VFG1563 Protein 3e-27 42
B446_14780 YP_008386585.1 two-component system response regulator VFG1390 Protein 1e-30 41
B446_14780 YP_008386585.1 two-component system response regulator VFG1702 Protein 3e-26 41