Gene Information

Name : B446_12385 (B446_12385)
Accession : YP_008386110.1
Strain : Streptomyces collinus Tu 365
Genome accession: NC_021985
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2862850 - 2863425 bp
Length : 576 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTATCGCTGACGAAGGAGGCCCCGGGCCTCACCGCCGTGATCGTAGGTCT
CGGGTGGGACGTGCGCACCACGACCGGCACCGACTTCGACCTCGACGCCAGCGCGCTGCTGCTGAACAGCTCCGGCAAGG
TCGCCAGCGACCAGCACTTCGTCTTCTTCAACAACCTCAAGAGCCCCGACGGCTCGGTCGAGCACACCGGTGACAACATC
ACCGGTGAGGGCGAGGGCGACGACGAGCAGATCAAGATCAACCTGGCCGGCGTCCCGGCCGACGTCGAGAAGATCGTCTT
CCCGGTGTCGATCTACGACGCCGAGAACCGCCAGCAGTCCTTCGGCCAGGTCCGCAACGCGTTCATCCGCGTGGTGAACC
AGGCGGGCGAGCAGGAGATCGCCCGCTACGACCTGAGCGAGGACGCCTCCACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGGCACGGCGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTATGCCTCGGGCCTGCGGGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVIVGLGWDVRTTTGTDFDLDASALLLNSSGKVASDQHFVFFNNLKSPDGSVEHTGDNI
TGEGEGDDEQIKINLAGVPADVEKIVFPVSIYDAENRQQSFGQVRNAFIRVVNQAGEQEIARYDLSEDASTETAMVFGEL
YRHGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-59 68
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-56 67
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-56 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-56 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-54 65
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-24 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_12385 YP_008386110.1 tellurium resistance protein BAC0389 Protein 1e-57 66
B446_12385 YP_008386110.1 tellurium resistance protein BAC0390 Protein 2e-56 65
B446_12385 YP_008386110.1 tellurium resistance protein BAC0392 Protein 1e-23 41