Gene Information

Name : B446_12380 (B446_12380)
Accession : YP_008386109.1
Strain : Streptomyces collinus Tu 365
Genome accession: NC_021985
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2862171 - 2862749 bp
Length : 579 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAACGTCTCCCTCTCCAAAGCCGCACCGAACCTCACCAACGTCCTGATCGGGCT
CGGCTGGGACGCGCGCTCCACCACCGGCGCCCCCTTCGACCTCGACGCCAGCGCCCTGCTGTGCGACGGGAGCAACCGGG
TGCTGGGGGACGAGTGGTTCGTGTTCTACAACCAGCTCACCAGCCCCGACGGCTCGGTCGAGCACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAATCGATTCTGATCGACCTGACCAGGGTCTCGCCCCAGTGCGAGAAGGTCATCTT
CCCCGTCTCGATCCACCTGGCGGACGAGCGCGGCCAGACCTTCGGGCAGGTGTCCAACGCGTTCATCCGCGTGGTCAACC
AGGCCGACGGGCAGGAACTGGCCCGCTACGACCTCAGCGAGGACGCCAGCACCGAGACCGCGATGATCTTCGGCGAGCTC
TACCGCTACCAGGGCGAATGGAAGTTCAGGGCCGTGGGACAGGGGTACGCCTCGGGTCTGCGCGGCATCGCTCTAGACTT
CGGAGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTNVLIGLGWDARSTTGAPFDLDASALLCDGSNRVLGDEWFVFYNQLTSPDGSVEHTGDNL
TGEGEGDDESILIDLTRVSPQCEKVIFPVSIHLADERGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGEL
YRYQGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-56 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-59 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-53 60
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-52 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-52 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-54 58
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-28 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_12380 YP_008386109.1 tellurium resistance protein BAC0389 Protein 6e-55 64
B446_12380 YP_008386109.1 tellurium resistance protein BAC0390 Protein 2e-57 62
B446_12380 YP_008386109.1 tellurium resistance protein BAC0392 Protein 5e-26 41