Gene Information

Name : I137_12685 (I137_12685)
Accession : YP_008381955.1
Strain : Salmonella enterica S06004
Genome accession: NC_021984
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2718503 - 2718880 bp
Length : 378 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGCAGATTTTACCCTCACTCCCGCCCGGGGCGACTTCGTCACACCCCACGCCTGTCGGCATCTGGCAGACCCTGCTGTC
GCATCTGCTGCAACAACACTACGGTCTGATGCTGAACGACACCCCGTTTGCTAACGACGGCGTCATTGAGCAGCATATCA
ACGCCGGCATCTCCCTGTGCGATGCGCTGAACGGTATTGTTGAAAAATATGACCTGGTCCGGACCGACCGCCCGGGATTC
AGTATTGCAGTGCAGTCTCCGTTCATTACCCGTATCGATATTCTCCGCGCCAGAAAAGCCTGTGGCCTGATGAAACGTCG
TGGCTACCGGGCCGTTACCGACATCACCACCGGCAGATACAGCGGGGGGGCACGATGA

Protein sequence :
MQILPSLPPGATSSHPTPVGIWQTLLSHLLQQHYGLMLNDTPFANDGVIEQHINAGISLCDALNGIVEKYDLVRTDRPGF
SIAVQSPFITRIDILRARKACGLMKRRGYRAVTDITTGRYSGGAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-32 64
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-32 64
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 5e-34 63
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 7e-34 63
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 7e-33 63
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-32 63
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 2e-33 62
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-33 62
unnamed AAL08478.1 unknown Not tested SRL Protein 1e-32 61
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 2e-32 61
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 2e-32 61
unnamed AAC31486.1 L0007 Not tested LEE Protein 1e-32 61
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 1e-32 61
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 1e-33 61
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 2e-33 61
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 2e-33 61
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-33 61
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 8e-33 61
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 4e-32 61
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 6e-33 61
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 4e-33 60
unnamed AAL57575.1 unknown Not tested LEE Protein 1e-31 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I137_12685 YP_008381955.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1530 Protein 3e-34 63
I137_12685 YP_008381955.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0786 Protein 5e-33 61
I137_12685 YP_008381955.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1069 Protein 5e-33 61
I137_12685 YP_008381955.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1620 Protein 3e-33 61
I137_12685 YP_008381955.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1682 Protein 2e-32 61
I137_12685 YP_008381955.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0663 Protein 4e-34 61