Gene Information

Name : fliQ (I137_05705)
Accession : YP_008380651.1
Strain : Salmonella enterica S06004
Genome accession: NC_021984
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1271211 - 1271477 bp
Length : 267 bp
Strand : +
Note : with proteins FliP and FliR forms the core of the central channel in the flagella export apparatus; Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGAATGATTCTGAATTGACGCAATTTGTAACGCAACTTTTATGGATCGTCCTTTTTACGTCTATGCCGGTGGTGTTGGT
GGCATCGGTAGTTGGTGTCATCGTAAGCCTTGTTCAGGCCTTGACTCAAATACAGGACCAAACGCTACAGTTCATGATTA
AATTATTGGCAATTGCAATAACCTTAATGGTCAGCTACCCATGGCTTAGCGGTATCCTGTTGAATTATACCCGGCAGATA
ATGTTACGAATTGGAGAGCATGGTTGA

Protein sequence :
MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAITLMVSYPWLSGILLNYTRQI
MLRIGEHG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ssaS YP_216428.1 secretion system apparatus protein SsaS Virulence SPI-2 Protein 6e-27 100
ssaS NP_460385.1 type III secretion system apparatus protein Virulence SPI-2 Protein 6e-27 100
ssaS CAA68200.1 secretion system apparatus, SsaS Virulence SPI-2 Protein 4e-27 100
ssaS NP_805091.1 type III secretion protein Virulence SPI-2 Protein 7e-27 99
ssaS NP_456108.1 putative type III secretion protein Virulence SPI-2 Protein 7e-27 99
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 7e-04 48
lscS AAO18039.1 LscS Virulence TTSS locus Protein 3e-10 47
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 2e-08 47
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 2e-08 47
escS AAK26701.1 EscS Virulence LEE Protein 3e-07 45
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 4e-07 45
escS AAL57528.1 EscS Virulence LEE Protein 3e-07 45
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 4e-07 45
escS CAC81848.1 EscS protein Virulence LEE II Protein 3e-07 45
escS CAI43888.1 EscS protein Virulence LEE Protein 3e-07 44
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 0.042 44
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 0.042 44
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 0.042 44
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 0.010 44
escS AAC38370.1 EscS Virulence LEE Protein 5e-07 43
escS AAC31527.1 L0048 Virulence LEE Protein 5e-07 43
escS ACU09472.1 hypothetical protein Not tested LEE Protein 5e-07 43
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 7e-07 43
escS NP_290282.1 hypothetical protein Virulence LEE Protein 7e-07 43
unnamed AAL06355.1 EscS Virulence LEE Protein 3e-07 43
ECs4582 NP_312609.1 EscS Virulence LEE Protein 7e-07 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_008380651.1 flagellar biosynthesis protein FliQ VFG0520 Protein 2e-27 100
fliQ YP_008380651.1 flagellar biosynthesis protein FliQ VFG0395 Protein 1e-11 52
fliQ YP_008380651.1 flagellar biosynthesis protein FliQ VFG0187 Protein 2e-05 46
fliQ YP_008380651.1 flagellar biosynthesis protein FliQ VFG0043 Protein 2e-06 44
fliQ YP_008380651.1 flagellar biosynthesis protein FliQ VFG0826 Protein 2e-07 43
fliQ YP_008380651.1 flagellar biosynthesis protein FliQ VFG0716 Protein 2e-07 43
fliQ YP_008380651.1 flagellar biosynthesis protein FliQ VFG2132 Protein 9e-05 43