Gene Information

Name : CYCME_2509 (CYCME_2509)
Accession : YP_008375173.1
Strain : Cycloclasticus zancles 7-ME
Genome accession: NC_021917
Putative virulence/resistance : Resistance
Product : Mercuric transport protein periplasmic component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2548597 - 2548869 bp
Length : 273 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAAATTGCTTTATTGACATTACTTGCACTGACAAGCCTGACCGCCTTTGCGAAACAGCAAACCGTGACCCTGGT
AGTACCCACCATGAACTGTGTGACGTGTCCCTTTACCGTGAAGAAAGCCTTACAAAACGTCGAGGGCGTCAGTAAAGCCG
AAGTGACCTTTGAGACCAAGCTTGCCGTGGTGACGTTTGACGACGAAAAAACCACCGTTAACACCCTGACTGAAGCAACC
AAGAATGTAGGCTATCCGTCTACCATCAAATGA

Protein sequence :
MKKIALLTLLALTSLTAFAKQQTVTLVVPTMNCVTCPFTVKKALQNVEGVSKAEVTFETKLAVVTFDDEKTTVNTLTEAT
KNVGYPSTIK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-17 64
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-17 64
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-17 64
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-17 64
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-17 64
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-17 64
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-17 63
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-17 63
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 2e-16 61
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 6e-18 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYCME_2509 YP_008375173.1 Mercuric transport protein periplasmic component BAC0675 Protein 4e-19 69
CYCME_2509 YP_008375173.1 Mercuric transport protein periplasmic component BAC0678 Protein 5e-18 67
CYCME_2509 YP_008375173.1 Mercuric transport protein periplasmic component BAC0231 Protein 1e-17 67
CYCME_2509 YP_008375173.1 Mercuric transport protein periplasmic component BAC0679 Protein 4e-18 67
CYCME_2509 YP_008375173.1 Mercuric transport protein periplasmic component BAC0674 Protein 6e-16 54