Gene Information

Name : CYCME_2507 (CYCME_2507)
Accession : YP_008375171.1
Strain : Cycloclasticus zancles 7-ME
Genome accession: NC_021917
Putative virulence/resistance : Resistance
Product : putative transcriptional regulators, MerR family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2547738 - 2548124 bp
Length : 387 bp
Strand : +
Note : -

DNA sequence :
ATGGCACAAACTATCAGCAAAGTGGCAAAAACACTGGCTATCAATGTTGAGACGATACGTTTCTATGAGCGTCGTGGATT
AATAGAGCAGCCAGCAAAACCGGAGGTTGGGTACCGTCATTACCCCAATGATACGATTAACCGAATTCGCTTTATTAAGC
GCTCCCAGGAGTTGGGGTTCACCCTGAATGAGATAGCCAATTTACTGAATCTGAATGATAGCCCCTGCGGCCAGGTTCAG
GAATTGGCCGAGCACAAACTCGCCGCCGTCAAAGATAAAATGGTGGATTTGCGTCGCCTGGAAAAAGCGCTCAACGCACT
CTTAGCCCAATGTCAAAGTAATGAGGATGATAGCCATTGTCCTATCATTGATTCCCTGCAACCTTAG

Protein sequence :
MAQTISKVAKTLAINVETIRFYERRGLIEQPAKPEVGYRHYPNDTINRIRFIKRSQELGFTLNEIANLLNLNDSPCGQVQ
ELAEHKLAAVKDKMVDLRRLEKALNALLAQCQSNEDDSHCPIIDSLQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-29 48
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-29 48
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 4e-29 47
merR AFG30124.1 MerR Not tested PAGI-2 Protein 4e-29 47
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-29 47
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 6e-29 47
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-29 47
merR ACK44535.1 MerR Not tested SGI1 Protein 4e-29 47
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-28 45
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 9e-29 45
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 7e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0687 Protein 2e-29 48
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0686 Protein 2e-30 48
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0684 Protein 1e-30 48
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0232 Protein 2e-29 48
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0683 Protein 5e-30 48
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0688 Protein 2e-30 48
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0689 Protein 1e-28 47
CYCME_2507 YP_008375171.1 putative transcriptional regulators, MerR family BAC0682 Protein 1e-23 44