Name : fliQ (REMIM1_CH00698) Accession : YP_008363479.1 Strain : Rhizobium etli Mim1 Genome accession: NC_021905 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : - COG ID : - EC number : - Position : 697352 - 697618 bp Length : 267 bp Strand : + Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum DNA sequence : ATGAATGAAGCTGATGCATTGGATCTGTTCCAGGCGGCAATCTGGACCGTGCTGATTGCCTCCGGTCCGGCGGTCCTCGC CGCGATGGTGGTGGGTCTCGTCATTGCCTTGATCCAGGCGTTGACCCAGGTGCAGGAAGCGACACTCACCTTCGTGCCGA AGATTGTCGCAGTGCTCGTCGTGGTCGGAATCACCGCCCCCTTCGTCGGCTCGCAGATCTCCATTTTCACCAATCTGGTC TTTTCGCGCATCCAGTCCGGCTTCTAG Protein sequence : MNEADALDLFQAAIWTVLIASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLVVVGITAPFVGSQISIFTNLV FSRIQSGF |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 7e-11 | 44 |
escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 2e-08 | 42 |
escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 2e-08 | 42 |
escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 4e-09 | 41 |
unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 4e-09 | 41 |
escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 4e-09 | 41 |
escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 4e-09 | 41 |
escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 5e-09 | 41 |
escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 5e-09 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
fliQ | YP_008363479.1 | flagellar biosynthesis protein FliQ | VFG0395 | Protein | 1e-11 | 42 |
fliQ | YP_008363479.1 | flagellar biosynthesis protein FliQ | VFG0187 | Protein | 2e-06 | 41 |