Gene Information

Name : SN31241_6610 (SN31241_6610)
Accession : YP_008358579.1
Strain : Salmonella enterica USMARC-S3124.1
Genome accession: NC_021902
Putative virulence/resistance : Virulence
Product : Intergenic-region protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 684682 - 685161 bp
Length : 480 bp
Strand : -
Note : Intergenic-region protein of Enterobacteriaceae UniRef RepID=Q8VRA1_ECOLX

DNA sequence :
ATGAAAAGCGTTTCTCAGAATACCCCCACAATTTATTCAGCTACAACACCAGAGAATAATCCGCCTCAGTTGGTTGCCAG
CCTCGTCCCTGATGAACAGCGCATCAGTTTCTGGCCACAGCACTTTGGCCTCATTCCACAGTGGGTGACCCTGGAGCCCC
GTATCTTCGGCTGGATGGACCGTCTGTGTGAAGACTACTGCGGTGGTATCTGGAATCTGTACACCCTGAACAACGGTGGC
GCATTTATGGCCCCCGAACCGGATGACGATGATGACGAAACATGGGTACTGTTCAATGCCATGAACGGTAACCGCGCTGA
AATGAGCCCGGAAGCCGCCGGCATTGCTGCCTGTCTGATGACGTACAGTCATCACGCCTGCCGTACGGAGTGTTATGCAA
TGACGGTTCATTATTACCGTCTGCGGGATTACGCCCTGCAACATCCGGAATACGACGCCATTATGCGCATTATTGACTGA

Protein sequence :
MKSVSQNTPTIYSATTPENNPPQLVASLVPDEQRISFWPQHFGLIPQWVTLEPRIFGWMDRLCEDYCGGIWNLYTLNNGG
AFMAPEPDDDDDETWVLFNAMNGNRAEMSPEAAGIAACLMTYSHHACRTECYAMTVHYYRLRDYALQHPEYDAIMRIID

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
S3200 NP_838483.1 hypothetical protein Not tested SHI-1 Protein 9e-60 90
SF2995 NP_708769.2 hypothetical protein Not tested SHI-1 Protein 9e-60 90
unnamed CAI43899.1 hypothetical protein Not tested LEE Protein 2e-59 90
unnamed AAL67346.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-59 89
ORF_48 AAZ04457.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-60 89
yfjX YP_854322.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-60 89
c5155 NP_757003.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-60 89
Z1216 NP_286751.1 hypothetical protein Not tested TAI Protein 1e-60 89
Z1656 NP_287159.1 hypothetical protein Not tested TAI Protein 1e-60 89
yfjX CAE85200.1 YfjX protein Not tested PAI V 536 Protein 4e-60 88
unnamed CAD66202.1 hypothetical protein Not tested PAI III 536 Protein 8e-64 88
ECO103_3588 YP_003223445.1 hypothetical protein Not tested LEE Protein 7e-58 88
z1216 CAD33786.1 Z1216 protein Not tested PAI I 536 Protein 1e-63 87
unnamed CAI43844.1 hypothetical protein Not tested LEE Protein 9e-65 86
yfjX ADD91703.1 YfjX Not tested PAI-I AL862 Protein 2e-63 86
aec72 AAW51755.1 Aec72 Not tested AGI-3 Protein 6e-63 85
unnamed CAD42097.1 hypothetical protein Not tested PAI II 536 Protein 4e-62 85

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SN31241_6610 YP_008358579.1 Intergenic-region protein VFG0659 Protein 2e-60 90
SN31241_6610 YP_008358579.1 Intergenic-region protein VFG1677 Protein 3e-64 88
SN31241_6610 YP_008358579.1 Intergenic-region protein VFG1527 Protein 5e-64 87
SN31241_6610 YP_008358579.1 Intergenic-region protein VFG1616 Protein 2e-62 85