Gene Information

Name : SN31241_5820 (SN31241_5820)
Accession : YP_008358500.1
Strain : Salmonella enterica USMARC-S3124.1
Genome accession: NC_021902
Putative virulence/resistance : Resistance
Product : Regulatory protein soxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 607041 - 607364 bp
Length : 324 bp
Strand : -
Note : DNA-binding transcriptional regulator SoxS PRK10219; Regulatory protein soxS of Enterobacteriaceae UniRef RepID=SOXS_SALTY

DNA sequence : 
ATGTCGCATCAGCAGATAATTCAGACCCTTATCGAATGGATTGATGAACATATCGACCAACCGCTAAACATTGATGTGGT
GGCAAAAAAATCGGGCTACTCCAAGTGGTATTTGCAGCGGATGTTTCGTACGGTAACGCATCAAACATTAGGCGAGTATA
TTCGCCAGCGCCGTCTCCTGTTGGCGGCCGTTGAGCTACGAACGACCGAGCGCCCGATTTTTGATATCGCGATGGACCTG
GGCTATGTATCGCAGCAAACCTTCTCGCGTGTATTCCGCCGCGAGTTCGATCGCACTCCCAGCGATTACCGTCACCGCCT
GTAG

Protein sequence : 
MSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGEYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-46 100
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-21 50
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-21 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP001138.1.gene4488. Protein 5e-47 100
SN31241_5820 YP_008358500.1 Regulatory protein soxS NC_002695.1.914293.p Protein 7e-46 96
SN31241_5820 YP_008358500.1 Regulatory protein soxS BAC0371 Protein 7e-46 96
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP000034.1.gene4505. Protein 1e-45 95
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP001918.1.gene327.p Protein 4e-45 95
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP000647.1.gene4499. Protein 3e-44 91
SN31241_5820 YP_008358500.1 Regulatory protein soxS NC_010558.1.6276025. Protein 2e-21 50
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP001138.1.gene612.p Protein 4e-25 49
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP000647.1.gene1624. Protein 7e-20 43
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP001918.1.gene2033. Protein 4e-20 43
SN31241_5820 YP_008358500.1 Regulatory protein soxS NC_002695.1.917339.p Protein 4e-20 42
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP001138.1.gene1637. Protein 5e-20 42
SN31241_5820 YP_008358500.1 Regulatory protein soxS BAC0560 Protein 4e-20 42
SN31241_5820 YP_008358500.1 Regulatory protein soxS CP000034.1.gene1596. Protein 4e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SN31241_5820 YP_008358500.1 Regulatory protein soxS VFG0585 Protein 4e-47 100
SN31241_5820 YP_008358500.1 Regulatory protein soxS VFG1038 Protein 2e-21 50