Gene Information

Name : rpmG (N220_01625)
Accession : YP_008337795.1
Strain : Mannheimia haemolytica USMARC_2286
Genome accession: NC_021883
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L33
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 313372 - 313542 bp
Length : 171 bp
Strand : +
Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th

DNA sequence :
ATGGCAGCTAAAGGCGCTCGTGAGAAAATCCGTTTAGTTTCTACAGCAGAAACTGGTCACTTCTACACAACAGATAAAAA
CAAACGTAATATGCCTGAAAAAATGGAAATCAAAAAATTTGATCCAGTTGTGCGTAAACACGTTATCTACAAAGAAGCAA
AAATTAAATAA

Protein sequence :
MAAKGAREKIRLVSTAETGHFYTTDKNKRNMPEKMEIKKFDPVVRKHVIYKEAKIK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0106 AAM75309.1 EF0106 Not tested Not named Protein 3e-06 44
rpmG NP_814353.1 50S ribosomal protein L33 Not tested Not named Protein 5e-06 44