Gene Information

Name : rpmE2 (N220_12225)
Accession : YP_008339859.1
Strain : Mannheimia haemolytica USMARC_2286
Genome accession: NC_021883
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2321588 - 2321860 bp
Length : 273 bp
Strand : +
Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g

DNA sequence :
ATGAAAAAAGGGATTCATCCTGAAAATTATCGTGAAGTGTTGTTCTATGATGCCTCAGTGCAACAAGGCTGGGTTATCCG
TTCTTGTGCGGCAACCAACAAAACAATGGTATGGGAAGATGGCAAAGAATACCCACTTTACACCTTAGATACCTCATCGG
CGTCTCACCCTGTTTACACAGGTAAACGCCGTGAAGTGAATACAGAAGGTCGTGCAAGTCAATTTAAAGATAGATTTAAA
GGCTTTGCTTCAACGCTTTCAAATCAAAAATAG

Protein sequence :
MKKGIHPENYREVLFYDASVQQGWVIRSCAATNKTMVWEDGKEYPLYTLDTSSASHPVYTGKRREVNTEGRASQFKDRFK
GFASTLSNQK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 7e-10 45
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 7e-10 45