Gene Information

Name : BDL_4336 (BDL_4336)
Accession : YP_008328117.1
Strain :
Genome accession: NC_021877
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1039027 - 1039716 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGCGAATACTGATCGTGGAAGACGAGCCGAAGACCGGCATGTATCTGCGCAAGGGGCTGACCGAAGCGGGCTTCATCGC
GGACTGGGTCGAGGACGGCGTGACGGGCCTGCATCAGGCCGAGACCGAGGAGTACGACCTGATCATCCTCGACGTGATGC
TGCCCGGCCACGACGGCTGGACGGTGCTCGAGCGGCTGCGCCGCGCGCACTCGACGCCCGTGCTGTTCCTGACCGCGCGC
GACGACGTCGGCGACCGCGTGAAGGGGCTCGAGCTCGGCGCGGACGATTACGTCGTCAAGCCGTTCGATTTCGTCGAGCT
GGTCGCGCGCGTGCGCTCGATCCTGCGCCGCGGGCAGGCGCGCGAATCGACGGTCCTGCGGATCGCCGATCTGGAGCTCG
ACCTGACGCGGCGCAAGGCCACGCGCCAGGGCGACGTCGTGCTGCTGACCGCGAAGGAATTCGCGCTGCTGTGGCTGCTG
ATGCGCCGCGAGGGCGAGATCCTGCCGCGCGCGACGATCGCCTCGCAGGTGTGGGACATGAATTTCAACAGCGACACGAA
CGTCGTCGACGCGGCGATCCGCCGGCTGCGCTCGAAGATCGACGACGCGTACGAGCCGAAGCTGATCCACACGGTGCGCG
GGATGGGCTACGTGCTCGAAGTCAGAAGCGCGAGCGCGCCGAGCCGATGA

Protein sequence :
MRILIVEDEPKTGMYLRKGLTEAGFIADWVEDGVTGLHQAETEEYDLIILDVMLPGHDGWTVLERLRRAHSTPVLFLTAR
DDVGDRVKGLELGADDYVVKPFDFVELVARVRSILRRGQARESTVLRIADLELDLTRRKATRQGDVVLLTAKEFALLWLL
MRREGEILPRATIASQVWDMNFNSDTNVVDAAIRRLRSKIDDAYEPKLIHTVRGMGYVLEVRSASAPSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-59 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-58 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BDL_4336 YP_008328117.1 response regulator BAC0197 Protein 8e-104 100
BDL_4336 YP_008328117.1 response regulator BAC0083 Protein 9e-68 64
BDL_4336 YP_008328117.1 response regulator BAC0125 Protein 3e-68 64
BDL_4336 YP_008328117.1 response regulator BAC0308 Protein 3e-66 63
BDL_4336 YP_008328117.1 response regulator BAC0638 Protein 2e-60 61
BDL_4336 YP_008328117.1 response regulator BAC0111 Protein 9e-64 59
BDL_4336 YP_008328117.1 response regulator BAC0347 Protein 6e-59 56
BDL_4336 YP_008328117.1 response regulator NC_010079.5776364.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator NC_002952.2859858.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator NC_007622.3794948.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator NC_003923.1003417.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator NC_013450.8614146.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator NC_002951.3238224.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator NC_007793.3914065.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator NC_002758.1121390.p0 Protein 9e-38 43
BDL_4336 YP_008328117.1 response regulator AE015929.1.gene1106. Protein 1e-31 42
BDL_4336 YP_008328117.1 response regulator NC_002952.2859905.p0 Protein 9e-33 42
BDL_4336 YP_008328117.1 response regulator NC_009641.5332272.p0 Protein 6e-33 42
BDL_4336 YP_008328117.1 response regulator NC_013450.8614421.p0 Protein 6e-33 42
BDL_4336 YP_008328117.1 response regulator NC_007793.3914279.p0 Protein 6e-33 42
BDL_4336 YP_008328117.1 response regulator NC_003923.1003749.p0 Protein 8e-33 42
BDL_4336 YP_008328117.1 response regulator NC_002745.1124361.p0 Protein 6e-33 42
BDL_4336 YP_008328117.1 response regulator NC_009782.5559369.p0 Protein 6e-33 42
BDL_4336 YP_008328117.1 response regulator NC_002951.3237708.p0 Protein 6e-33 42
BDL_4336 YP_008328117.1 response regulator NC_007622.3794472.p0 Protein 9e-33 42
BDL_4336 YP_008328117.1 response regulator NC_002758.1121668.p0 Protein 6e-33 42
BDL_4336 YP_008328117.1 response regulator AE000516.2.gene3505. Protein 2e-28 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BDL_4336 YP_008328117.1 response regulator VFG0596 Protein 1e-59 58
BDL_4336 YP_008328117.1 response regulator VFG1389 Protein 5e-32 44
BDL_4336 YP_008328117.1 response regulator VFG1386 Protein 2e-35 43
BDL_4336 YP_008328117.1 response regulator VFG1390 Protein 2e-36 41