Gene Information

Name : A464_1035 (A464_1035)
Accession : YP_008321631.1
Strain : Salmonella bongori N268-08
Genome accession: NC_021870
Putative virulence/resistance : Virulence
Product : Putative two-component system response regulator YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1064542 - 1065222 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence : 
ATGAAGATTTTATTGATTGAAGATAACCAAAAAACTATGGAATGGGTACGTCAGGGACTCACTGAAGCAGGCTATGTGGT
GGATGCTGCCTGTGATGGACGAGATGGACTACACCTGGCGCTCAGGGAGACTTATTCATTGATTATTCTTGATATTATGC
TGCCCGGCCTTGATGGCTGGCAAGTGTTACGCGCATTACGCACAGTACAGTCTCCGCCTGTTATCTGCCTGACGGCACGG
GACTCGGTTGAAGACCGAGTCAAAGGTCTGGAAGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCTTTCGCCGAACT
GCTGGCCAGAGTGAGAGCTCAACTCAGACAACACGTTCCTGTTGCGACCCGGCTGACGATCGATGGTCTGGACATGGATG
CTACAAAGCAGTCGGTATCGCGAAATGGAAAGCCTATTTCCCTGACCCGCAAGGAATTTCTACTTCTCTGGCTTCTGGCG
TCCCGGGCAGGAGAAATTGTGCCCCGAACCGCGATTGCCAGCGAGGTATGGGGTATCAATTTTGACAGTGAAACCAACAC
CGTTGATGTCGCCATTCGAAGGCTTCGCGCCAAAGTAGACGATCCGTTTGACGAGAAACTCATTATGACCGTCCGGGGAA
TGGGTTATCGATTACAACCAGAAGCCTCGCAGAATGATTAA

Protein sequence : 
MKILLIEDNQKTMEWVRQGLTEAGYVVDAACDGRDGLHLALRETYSLIILDIMLPGLDGWQVLRALRTVQSPPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVATRLTIDGLDMDATKQSVSRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDDPFDEKLIMTVRGMGYRLQPEASQND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-97 93
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-96 92

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW BAC0197 Protein 1e-58 59
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW BAC0125 Protein 4e-60 57
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW BAC0083 Protein 6e-57 56
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW BAC0638 Protein 6e-53 56
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW BAC0308 Protein 6e-54 55
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW BAC0111 Protein 1e-56 52
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW BAC0347 Protein 3e-50 51
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_003923.1003417.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_013450.8614146.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_002951.3238224.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_007793.3914065.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_002758.1121390.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_010079.5776364.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_002952.2859858.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW NC_007622.3794948.p0 Protein 2e-41 46
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW AE015929.1.gene1106. Protein 6e-35 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW VFG0596 Protein 3e-97 93
A464_1035 YP_008321631.1 Putative two-component system response regulator YedW VFG1389 Protein 2e-32 43