Gene Information

Name : CFSAN002050_00355 (CFSAN002050_00355)
Accession : YP_008310892.1
Strain :
Genome accession: NC_021845
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 78907 - 79272 bp
Length : 366 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGAGCGCCTACACAGTGTCCCGGCTGGCCCTTGATGCCGGGGTGAGCGTGCATATCGTGCGCGACTACCTGCTGCGCGG
ATTGCTACGGCCGGTCGCGTACACCACGGGCGGCTACGGCTTGTTCGATGACACCGCGTTGCAACGGCTGCGCTTTGTAC
GGGCTGCCTTCGAAGCGGGTATCGGCCTGGACGCACTGGCGCGGCTGTGCCGGGCGCTGGATGCTGCGGACGGTGACGGT
GCGTCTGCGCAGCTTGCCGTGTTGCGGCAACTCGTCGAGCGTCGGCGCGAGGCCCTGGCCAGCCTCGAAATGCAACTGGC
CGCCATGCCAACCGAACCGGCACAGCACGCGGAGAGTCTGCCATGA

Protein sequence :
MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVAYTTGGYGLFDDTALQRLRFVRAAFEAGIGLDALARLCRALDAADGDG
ASAQLAVLRQLVERRREALASLEMQLAAMPTEPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ACN81004.1 MerD Not tested AbaR5 Protein 2e-36 100
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 1e-36 100
merD AGK07020.1 MerD Not tested SGI1 Protein 8e-32 90
merD AGK07078.1 MerD Not tested SGI1 Protein 8e-32 90
merD ABQ57370.1 MerD Not tested SGI1 Protein 2e-31 89
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 1e-27 83
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 7e-28 83
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 7e-28 83
merD AFG30119.1 MerD Not tested PAGI-2 Protein 7e-28 83

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN002050_00355 YP_008310892.1 transcriptional regulator BAC0666 Protein 3e-32 91
CFSAN002050_00355 YP_008310892.1 transcriptional regulator BAC0668 Protein 3e-32 90
CFSAN002050_00355 YP_008310892.1 transcriptional regulator BAC0665 Protein 4e-33 90
CFSAN002050_00355 YP_008310892.1 transcriptional regulator BAC0667 Protein 3e-34 89
CFSAN002050_00355 YP_008310892.1 transcriptional regulator BAC0227 Protein 7e-32 89
CFSAN002050_00355 YP_008310892.1 transcriptional regulator BAC0669 Protein 2e-33 84