Name : SEEB0189_21125 (SEEB0189_21125) Accession : YP_008310497.1 Strain : Salmonella enterica CFSAN000189 Genome accession: NC_021844 Putative virulence/resistance : Resistance Product : transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 4337182 - 4337505 bp Length : 324 bp Strand : + Note : regulates genes involved in response to oxidative stress; Derived by automated computational analysis using gene prediction method: Protein Homology. DNA sequence : ATGTCGCATCAGCAGATAATTCAGACCCTTATCGAATGGATTGATGAACATATCGACCAACCGCTAAACATTGATGTGGT GGCAAAAAAATCGGGCTATTCCAAGTGGTATTTGCAGCGGATGTTTCGTACGGTAACGCATCAAACATTAGGCGAGTATA TTCGCCAGCGCCGTCTCCTGTTGGCGGCCGTTGAGCTACGAACGACCGAGCGCCCGATTTTTGATATCGCGATGGACCTG GGCTATGTATCGCAGCAAACCTTCTCGCGTGTATTCCGCCGCGAGTTCGATCGCACTCCCAGCGATTACCGTCACCGCCT GTAG Protein sequence : MSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGEYIRQRRLLLAAVELRTTERPIFDIAMDL GYVSQQTFSRVFRREFDRTPSDYRHRL |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
soxS | YP_219131.1 | DNA-binding transcriptional regulator SoxS | Not tested | SPI-4 | Protein | 1e-46 | 100 |
tetD | AAL08447.1 | putative transcriptional regulator TetD | Not tested | SRL | Protein | 4e-21 | 50 |
tetD | AEA34665.1 | tetracycline resistance protein D | Not tested | Not named | Protein | 4e-21 | 50 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP001138.1.gene4488. | Protein | 5e-47 | 100 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | NC_002695.1.914293.p | Protein | 7e-46 | 96 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | BAC0371 | Protein | 7e-46 | 96 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP000034.1.gene4505. | Protein | 1e-45 | 95 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP001918.1.gene327.p | Protein | 4e-45 | 95 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP000647.1.gene4499. | Protein | 3e-44 | 91 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | NC_010558.1.6276025. | Protein | 2e-21 | 50 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP001138.1.gene612.p | Protein | 4e-25 | 49 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP000647.1.gene1624. | Protein | 7e-20 | 43 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP001918.1.gene2033. | Protein | 4e-20 | 43 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | NC_002695.1.917339.p | Protein | 4e-20 | 42 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP001138.1.gene1637. | Protein | 5e-20 | 42 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | BAC0560 | Protein | 4e-20 | 42 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | CP000034.1.gene1596. | Protein | 4e-20 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | VFG0585 | Protein | 4e-47 | 100 |
SEEB0189_21125 | YP_008310497.1 | transcriptional regulator | VFG1038 | Protein | 2e-21 | 50 |