Gene Information

Name : SEEB0189_17950 (SEEB0189_17950)
Accession : YP_008309881.1
Strain : Salmonella enterica CFSAN000189
Genome accession: NC_021844
Putative virulence/resistance : Virulence
Product : antitoxin YeeU
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3666383 - 3666754 bp
Length : 372 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGACGAAGACCACAACCACCGTACATGACCTCACGTCTCCCTGGTGGGGACTCCGCCGCAATGTGTCACCATGTTTTGG
CGCACGGCTGGTTCAGGAGGGCAACCGCCTGCATTACCTGGCTGACCGCGCCGGCATTACCGGACAGTTCAGCGACGCGG
ATTTACGTCACCTGGACCAGGCCTTTCCGGTACTGCTGAAACAACTGGAGCTGATGTTACTTTCCGGTGAGCTTAATCCC
CGCCATCAGCACTGCGTCACCCTGTACGCAAAGGGACTGGTATGCGAGGCCGACTCACTCGGGTCGTGCGGCTACATTTA
TCTCGCCATTTACCCCGGAGAACCGCCTGAAACCGGAGGTATGGCACGATGA

Protein sequence :
MTKTTTTVHDLTSPWWGLRRNVSPCFGARLVQEGNRLHYLADRAGITGQFSDADLRHLDQAFPVLLKQLELMLLSGELNP
RHQHCVTLYAKGLVCEADSLGSCGYIYLAIYPGEPPETGGMAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 2e-35 81
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 1e-36 79
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 1e-37 78
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 3e-37 75
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 8e-37 74
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 8e-37 74
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 2e-36 74
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-36 74
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 7e-38 72
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 5e-38 72
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 1e-35 72
Z1658 NP_287161.1 structural protein Not tested TAI Protein 2e-36 70
Z1220 NP_286755.1 structural protein Not tested TAI Protein 2e-36 70
unnamed AAL57576.1 unknown Not tested LEE Protein 2e-35 70
unnamed AAL08477.1 unknown Not tested SRL Protein 9e-37 69
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 6e-38 69
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 6e-38 69
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 4e-38 69

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEB0189_17950 YP_008309881.1 antitoxin YeeU VFG1681 Protein 1e-35 81
SEEB0189_17950 YP_008309881.1 antitoxin YeeU VFG1619 Protein 3e-37 74
SEEB0189_17950 YP_008309881.1 antitoxin YeeU VFG1068 Protein 4e-37 69
SEEB0189_17950 YP_008309881.1 antitoxin YeeU VFG0662 Protein 2e-38 69