Gene Information

Name : SEEB0189_16375 (SEEB0189_16375)
Accession : YP_008309570.1
Strain : Salmonella enterica CFSAN000189
Genome accession: NC_021844
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3338286 - 3338627 bp
Length : 342 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGACCATTTCCGCTCAGGTTATCGACACGATTGTCGAGTGGATTGATGATAATTTGAATCAGCCGTTACGTATTGATGA
TATTGCCCGTCATGCGGGGTATTCCAAGTGGCACCTGCAGCGCCTTTTTATGCAGTACAAAGGGGAGAGTCTGGGACGCT
ACGTGCGTGAACGGAAGCTAAAACTGGCGGCGCGCGACCTGCTCGACACCGACCAGAAGGTGTATGATATTTGTCTCAAG
TATGGTTTTGATTCGCAGCAAACCTTTACGCGCATTTTTACCCGCACGTTCAACCTGCCGCCAGGCGCTTATCGTAAAGA
AAAGCATGGCCGTACGCATTGA

Protein sequence :
MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQYKGESLGRYVRERKLKLAARDLLDTDQKVYDICLK
YGFDSQQTFTRIFTRTFNLPPGAYRKEKHGRTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 5e-18 48
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-16 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-16 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP001138.1.gene612.p Protein 4e-43 99
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP001918.1.gene327.p Protein 1e-18 48
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP000647.1.gene4499. Protein 3e-18 48
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP001138.1.gene4488. Protein 2e-18 48
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP000647.1.gene1624. Protein 1e-17 46
SEEB0189_16375 YP_008309570.1 transcriptional regulator NC_010558.1.6276025. Protein 6e-17 46
SEEB0189_16375 YP_008309570.1 transcriptional regulator NC_002695.1.914293.p Protein 2e-17 45
SEEB0189_16375 YP_008309570.1 transcriptional regulator BAC0371 Protein 2e-17 45
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP001918.1.gene2033. Protein 5e-18 45
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP000034.1.gene4505. Protein 4e-17 44
SEEB0189_16375 YP_008309570.1 transcriptional regulator BAC0560 Protein 3e-18 43
SEEB0189_16375 YP_008309570.1 transcriptional regulator NC_002695.1.917339.p Protein 3e-18 43
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP000034.1.gene1596. Protein 3e-18 43
SEEB0189_16375 YP_008309570.1 transcriptional regulator CP001138.1.gene1637. Protein 4e-18 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEB0189_16375 YP_008309570.1 transcriptional regulator VFG0585 Protein 1e-18 48
SEEB0189_16375 YP_008309570.1 transcriptional regulator VFG1038 Protein 6e-17 46