Gene Information

Name : rpmE2 (M641_01360)
Accession : YP_008297825.1
Strain : Listeria monocytogenes R2-502
Genome accession: NC_021838
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 242474 - 242719 bp
Length : 246 bp
Strand : -
Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g

DNA sequence :
ATGAAAACTGGAATTCATCCTGAGTACCGTCCAGTGGTATTTGTTGATACTAGTACTGATTTCAAATTTTTGTCAGGTTC
TACTAAGAGCTCAAGCGAAACAATTAAATGGGAAGATGGCAACGAGTATCCATTACTACGTGTCGAAATCTCTTCTGATT
CGCACCCGTTCTATACTGGTAAACAAAAACATGCGACTGCAGACGGCCGTGTGGACCGCTTCAACAAAAAATACGGTCTC
AAATAA

Protein sequence :
MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEISSDSHPFYTGKQKHATADGRVDRFNKKYGL
K

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 9e-13 50
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 9e-13 50