Name : CFSAN002050_05910 (CFSAN002050_05910) Accession : YP_008259128.1 Strain : Salmonella enterica CFSAN002050 Genome accession: NC_021818 Putative virulence/resistance : Virulence Product : regulatory protein Function : - COG functional category : - COG ID : - EC number : - Position : 888950 - 889156 bp Length : 207 bp Strand : - Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+. DNA sequence : ATGACAACATTACCTTCTGAAGTAAACGATGAATTAGTCGATATGAAATTTATTACTAAATATTCAAAACTAACGGACAA ATGGTTTTACAAGCTGATTAAAGATGGCGAGTTTCCAAAACCTATAAAGCTGGGTCGCAGTTCCCGCTGGTTACGCAGTG AGGTGGAAACCTGGTTCCAGAAGCGCATTGATGAATCACGTCAGTAG Protein sequence : MTTLPSEVNDELVDMKFITKYSKLTDKWFYKLIKDGEFPKPIKLGRSSRWLRSEVETWFQKRIDESRQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 8e-19 | 70 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-18 | 67 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-18 | 67 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-18 | 67 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 3e-18 | 67 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 8e-18 | 67 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-17 | 67 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 2e-18 | 67 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 2e-18 | 67 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-14 | 65 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-14 | 65 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 3e-18 | 64 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
CFSAN002050_05910 | YP_008259128.1 | regulatory protein | VFG0651 | Protein | 9e-19 | 67 |
CFSAN002050_05910 | YP_008259128.1 | regulatory protein | VFG1480 | Protein | 3e-18 | 67 |
CFSAN002050_05910 | YP_008259128.1 | regulatory protein | VFG1057 | Protein | 1e-18 | 64 |