Gene Information

Name : CFSAN002050_05910 (CFSAN002050_05910)
Accession : YP_008259128.1
Strain : Salmonella enterica CFSAN002050
Genome accession: NC_021818
Putative virulence/resistance : Virulence
Product : regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 888950 - 889156 bp
Length : 207 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGACAACATTACCTTCTGAAGTAAACGATGAATTAGTCGATATGAAATTTATTACTAAATATTCAAAACTAACGGACAA
ATGGTTTTACAAGCTGATTAAAGATGGCGAGTTTCCAAAACCTATAAAGCTGGGTCGCAGTTCCCGCTGGTTACGCAGTG
AGGTGGAAACCTGGTTCCAGAAGCGCATTGATGAATCACGTCAGTAG

Protein sequence :
MTTLPSEVNDELVDMKFITKYSKLTDKWFYKLIKDGEFPKPIKLGRSSRWLRSEVETWFQKRIDESRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 8e-19 70
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 3e-18 67
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-18 67
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 3e-18 67
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 3e-18 67
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 8e-18 67
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 67
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 2e-18 67
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 2e-18 67
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-14 65
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-14 65
unnamed AAL08466.1 unknown Not tested SRL Protein 3e-18 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN002050_05910 YP_008259128.1 regulatory protein VFG0651 Protein 9e-19 67
CFSAN002050_05910 YP_008259128.1 regulatory protein VFG1480 Protein 3e-18 67
CFSAN002050_05910 YP_008259128.1 regulatory protein VFG1057 Protein 1e-18 64