Gene Information

Name : CFSAN001921_15750 (CFSAN001921_15750)
Accession : YP_008256498.1
Strain : Salmonella enterica CFSAN001921
Genome accession: NC_021814
Putative virulence/resistance : Unknown
Product : isocitrate lyase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3193112 - 3193459 bp
Length : 348 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGATATCTCTCCCTGCAGGTTCGCGTATCTGGCTGGTTGCAGGTATCACCGATATGCGAAATGGCTTTAACGGCCTGGC
ATCAAAAGTTCAGAACGTCCTGAAGGATGACCCGTTCTCCGGACACCTGTTCATCTTCCGCGGACGCCGGGGTGACCAGA
TAAAAGTGTTGTGGGCTGACAGTGACGGACTGTGCCTCTTCACCAAACGCCTGGAGCGGGGCCGCTTCGTCTGGCCAGTC
ACCCGTGACGGCAAGGTGCACCTTACTCCGGCTCAGTTATCCATGCTTCTTGAAGGTATCAACTGGAAGCACCCGAAACG
AACGGAACGCGCTGGAATCCGCATATAA

Protein sequence :
MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFIFRGRRGDQIKVLWADSDGLCLFTKRLERGRFVWPV
TRDGKVHLTPAQLSMLLEGINWKHPKRTERAGIRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-50 100
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-50 100
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 9e-50 99
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-45 82
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-45 82
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-39 77
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-39 77
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-30 76
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-39 76
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-39 76
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-39 76
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-39 76
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-38 76
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-39 76
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-38 76
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-39 76
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-39 76
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-39 76
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-39 75
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-38 70
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-38 70
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-38 69
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-38 69
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-38 69
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-30 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN001921_15750 YP_008256498.1 isocitrate lyase VFG1665 Protein 4e-50 99
CFSAN001921_15750 YP_008256498.1 isocitrate lyase VFG1698 Protein 4e-40 77
CFSAN001921_15750 YP_008256498.1 isocitrate lyase VFG1517 Protein 7e-31 76
CFSAN001921_15750 YP_008256498.1 isocitrate lyase VFG0792 Protein 1e-39 76
CFSAN001921_15750 YP_008256498.1 isocitrate lyase VFG1709 Protein 1e-39 76
CFSAN001921_15750 YP_008256498.1 isocitrate lyase VFG1052 Protein 2e-39 75
CFSAN001921_15750 YP_008256498.1 isocitrate lyase VFG1737 Protein 4e-39 69