Gene Information

Name : SEEH1578_04355 (SEEH1578_04355)
Accession : YP_008244944.1
Strain : Salmonella enterica 41578
Genome accession: NC_021810
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 776006 - 776197 bp
Length : 192 bp
Strand : -
Note : COG2801 Transposase and inactivated derivatives

DNA sequence :
ATGTCCCGCAAAGGCAACTGCCTTGATAATGCCTGTGCAGAATGTTTTTTCGGGACTTTAAAATCAGAAAGTTTTTACAC
CAGTAAATTTAAGGATATTGATGAACTTAAGATAGCTATTGAGGATTACATACGATACTACAATACCCGACGAATTAGCC
TTAAATTTAACGGACTCAGCCCGGTTGAATAG

Protein sequence :
MSRKGNCLDNACAECFFGTLKSESFYTSKFKDIDELKIAIEDYIRYYNTRRISLKFNGLSPVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
M5005_Spy_0166 YP_281530.1 transposase Not tested Not named Protein 4e-04 44
unnamed CAD42036.1 hypothetical protein Not tested PAI II 536 Protein 5e-05 44
CD241_0076 YP_005124345.1 transposase-like protein Not tested Not named Protein 8e-06 43
EXB3 ABD94690.1 transposase derived protein Not tested ExoU island B Protein 2e-04 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEEH1578_04355 YP_008244944.1 transposase VFG1555 Protein 2e-05 44