Gene Information

Name : cusR (F504_4568)
Accession : YP_008238296.1
Strain :
Genome accession: NC_021745
Putative virulence/resistance : Virulence
Product : Copper-sensing two-component system response regulator CusR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1374704 - 1375390 bp
Length : 687 bp
Strand : +
Note : FIG00012686

DNA sequence :
ATGAAGCTGCTAGTCGTCGAAGACGAAGCCAAGACCGGCGAATACCTCCAGCAGGGCCTGACCGAGGCCGGGTTCGTGGT
GGACCTCGCCCGCAACGGCGTGGACGGCCTGCACCTCGCCACGACGGGCGACTACGACCTGCTGGTGCTCGACGTGATGC
TGCCCGACCTGGACGGCTGGCAGGTCGTGCAATCGCTGCGCGCGGCCGCGTGCGCGGTGCCGGTGCTGTTCCTGACCGCG
CGCGACAGCGTGGGCGACCGGGTCAAGGGGCTCGAGCTGGGCGCCGACGATTACCTGGTCAAGCCGTTCGCCTTCGCGGA
GCTGCTGGCGCGGGTCCGCACCCTGCTGCGCCGGGGCAGCACGCCGGTCGCGCTCGACCGCATCCAGATCGCCGACCTCG
TGCTCGACCTGGCCCGCCGCCGGGCCTCGCGCTCGGGGCAGCGGATCGCGCTGACCAGCAAGGAGTTCGCCCTGCTCGAA
CTGCTGGCCCGCCGCCGCGGCGAAGTGCTGCCGCGCTCGCTGATCGCCTCCCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAACGTGATCGACGTCGCCATCCGCCGGCTGCGCGCCAAGATCGACGACGACTTCACGCCGAAGCTGATCCAGACGG
TGCGCGGCATGGGCTACGTGCTCGAAGACCCGGAGGACGCGGCATGA

Protein sequence :
MKLLVVEDEAKTGEYLQQGLTEAGFVVDLARNGVDGLHLATTGDYDLLVLDVMLPDLDGWQVVQSLRAAACAVPVLFLTA
RDSVGDRVKGLELGADDYLVKPFAFAELLARVRTLLRRGSTPVALDRIQIADLVLDLARRRASRSGQRIALTSKEFALLE
LLARRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDFTPKLIQTVRGMGYVLEDPEDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-45 62
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-44 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR BAC0083 Protein 4e-57 71
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR BAC0111 Protein 6e-62 71
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR BAC0638 Protein 3e-59 70
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR BAC0197 Protein 4e-54 68
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR BAC0308 Protein 3e-53 66
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR BAC0125 Protein 1e-50 65
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR BAC0347 Protein 9e-53 64
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_002516.2.879194.p Protein 1e-21 42
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_002952.2859905.p0 Protein 9e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_007622.3794472.p0 Protein 8e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_002745.1124361.p0 Protein 6e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_009782.5559369.p0 Protein 6e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_002951.3237708.p0 Protein 6e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_002758.1121668.p0 Protein 6e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_009641.5332272.p0 Protein 6e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_013450.8614421.p0 Protein 6e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR NC_007793.3914279.p0 Protein 6e-23 41
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR AE000516.2.gene3505. Protein 2e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR VFG0596 Protein 3e-45 62
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR VFG1389 Protein 3e-27 48
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR VFG1390 Protein 2e-33 47
cusR YP_008238296.1 Copper-sensing two-component system response regulator CusR VFG1386 Protein 1e-25 42