Gene Information

Name : lhe_0751 (lhe_0751)
Accession : YP_008236192.1
Strain : Lactobacillus helveticus CNRZ32
Genome accession: NC_021744
Putative virulence/resistance : Virulence
Product : signal transduction response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 861124 - 861828 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
ATGGTTGAAGATGATAATTCCGTCGCTGAAATGATGGGAATGTTTTTCAAAAAAGAAGGTTGGCAGCAAGATATCGCTGT
CGACGGTGTCGAAGCCGTCGATATGTTTAAAGAAAATGCAGATAAGTATGATTTGATTACATTAGATTTGAATTTGCCTA
AAAAAGATGGTATTCAAGTTGCTAAGGAAGTAAGAGCTATTTCTCCTACTGTTCCGATTATTATGCTTACTGCTAGGGGC
AGTGAATCAGATCAAGTTCTAGGATTAGGAATTGGTGCTGATGAGTATGTGACTAAGCCATTTAGTCCAATCGCATTAAT
TGCCCGCATCAAGGCACTTCATCGTCGCGTGATGATGGAAGAAGACGTTCAAACACAAGAAAATAATAATCAAGAATATG
AAATTCAGACTGCTCATCTAAAGATTTCTAAGGATAGACGAGAAGTTTTATTTGATGACCAACTAGTTGTTGATTTAACG
CCGAAGGAATTTGATTTGTTATATACAATGGCGCAAAAGCCTAAGCAAGTCTTTTCGCGTGATCAATTATTAGATCTGGT
CTGGGGATATGAGTATTATGGTGAAGAACGAACTGTTGACGCCCATATTAAAAAATTGCGCCAAAAACTAGAAAAAGTTG
GTGCCAAGGTTATCCAAACAGTCTGGGGCGTTGGCTATAAGTTTGACGATTCGCAGGTCAAATAA

Protein sequence :
MVEDDNSVAEMMGMFFKKEGWQQDIAVDGVEAVDMFKENADKYDLITLDLNLPKKDGIQVAKEVRAISPTVPIIMLTARG
SESDQVLGLGIGADEYVTKPFSPIALIARIKALHRRVMMEEDVQTQENNNQEYEIQTAHLKISKDRREVLFDDQLVVDLT
PKEFDLLYTMAQKPKQVFSRDQLLDLVWGYEYYGEERTVDAHIKKLRQKLEKVGAKVIQTVWGVGYKFDDSQVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lhe_0751 YP_008236192.1 signal transduction response regulator HE999704.1.gene2815. Protein 4e-40 44
lhe_0751 YP_008236192.1 signal transduction response regulator NC_012469.1.7685629. Protein 6e-39 43
lhe_0751 YP_008236192.1 signal transduction response regulator CP001918.1.gene5135. Protein 2e-25 43
lhe_0751 YP_008236192.1 signal transduction response regulator NC_002952.2859905.p0 Protein 3e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_009782.5559369.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_002951.3237708.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_007622.3794472.p0 Protein 3e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_003923.1003749.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_002758.1121668.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_009641.5332272.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_013450.8614421.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_007793.3914279.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator NC_002745.1124361.p0 Protein 2e-39 42
lhe_0751 YP_008236192.1 signal transduction response regulator AF155139.2.orf0.gene Protein 2e-40 41
lhe_0751 YP_008236192.1 signal transduction response regulator FJ349556.1.orf0.gene Protein 3e-39 41
lhe_0751 YP_008236192.1 signal transduction response regulator AE000516.2.gene3505. Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lhe_0751 YP_008236192.1 signal transduction response regulator VFG1563 Protein 7e-34 42
lhe_0751 YP_008236192.1 signal transduction response regulator VFG1702 Protein 7e-34 42