
|
Name : M495_15500 (M495_15500) Accession : YP_008231039.1 Strain : Serratia liquefaciens ATCC 27592 Genome accession: NC_021741 Putative virulence/resistance : Resistance Product : ArsR family transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 3219008 - 3219337 bp Length : 330 bp Strand : - Note : regulates the expression of of the arsRBC involved in resistance to arsenic; Derived by automated computational analysis using gene prediction method: GeneMarkS+. DNA sequence : ATGACATCACTGACGCCACTGGCATTGTTTAAAAATCTGTCGGAGGAAACTCGCCTCACGCTGGTGCTTTTGCTGCGCCA GGCGGGTGAGCTGTGCGTGTGCGAATTGGTCAGCGCATTGGAGGAATCGCAACCCAAAGTTTCTCGTCACCTCGCGATGT TACGTGAAAGTGGTCTGCTGATCGATCGTCGCGAGGGCAAGTGGATTTACTACCGCCTGTCGCCGCATATGCCGGCCTGG GCGGCGGCAATCATCGAACAGGCTTACCTTAGCCGGCAACAGCAGGTGACCGAGCTGGCGCAGCGCGCGTTAGGGGCGGT CTGCCGGTAA Protein sequence : MTSLTPLALFKNLSEETRLTLVLLLRQAGELCVCELVSALEESQPKVSRHLAMLRESGLLIDRREGKWIYYRLSPHMPAW AAAIIEQAYLSRQQQVTELAQRALGAVCR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| arsR2 | YP_001007630.1 | DNA-binding transcriptional repressor ArsR | Not tested | YAPI | Protein | 2e-25 | 66 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| M495_15500 | YP_008231039.1 | ArsR family transcriptional regulator | BAC0589 | Protein | 8e-26 | 66 |
| M495_15500 | YP_008231039.1 | ArsR family transcriptional regulator | BAC0591 | Protein | 3e-25 | 64 |
| M495_15500 | YP_008231039.1 | ArsR family transcriptional regulator | BAC0588 | Protein | 3e-19 | 64 |
| M495_15500 | YP_008231039.1 | ArsR family transcriptional regulator | BAC0594 | Protein | 2e-22 | 61 |