Name : rpmG (J450_08475) Accession : YP_008220692.1 Strain : Mannheimia haemolytica D171 Genome accession: NC_021738 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : - COG ID : - EC number : - Position : 1752974 - 1753144 bp Length : 171 bp Strand : + Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCAGCTAAAGGCGCTCGTGAGAAAATCCGTTTAGTTTCTACAGCAGAAACTGGTCACTTCTACACAACAGATAAAAA CAAACGTAATATGCCTGAAAAAATGGAAATCAAAAAATTTGATCCAGTTGTGCGTAAACACGTTATCTACAAAGAAGCAA AAATTAAATAA Protein sequence : MAAKGAREKIRLVSTAETGHFYTTDKNKRNMPEKMEIKKFDPVVRKHVIYKEAKIK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 5e-06 | 44 |
ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 3e-06 | 44 |