Gene Information

Name : BJAB0715_p0046 (BJAB0715_p0046)
Accession : YP_008219042.1
Strain :
Genome accession: NC_021734
Putative virulence/resistance : Unknown
Product : Transposase-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 42108 - 42425 bp
Length : 318 bp
Strand : +
Note : COG:COG2963

DNA sequence :
ATGAAAAAACCAACCTATACCCCCGAAATTAGAGAAAGAGCGGTTCAATTACTAATTGAATCTGAAAAAGATTATCCTTC
TACTTGGGCTGCAATCACAGCAATTGCGCCTAAGATTGGTTGTACTCCTGAAACACTTCGTGCCTGGCATCAAAAGCATT
TAGATCAGCAAAATCCTATTAAAGTACAACAGATATCTGATCAAGAAAAAATGAAGCAAATGGAACGTGAAATTAAAGAA
TTAAAGCGTGCCAATGAAATTCTACGTAAAGCAGCCGCTTTTTTCGCCCAGGCGGAGCTCGACCGCCCACACAAATAA

Protein sequence :
MKKPTYTPEIRERAVQLLIESEKDYPSTWAAITAIAPKIGCTPETLRAWHQKHLDQQNPIKVQQISDQEKMKQMEREIKE
LKRANEILRKAAAFFAQAELDRPHK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 9e-21 50
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 1e-20 50
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 3e-21 50
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 4e-21 49
unnamed AAF09023.1 unknown Not tested SHI-O Protein 6e-22 49
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-22 49
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-22 49
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 6e-22 49
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-22 49
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-22 49
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 4e-22 49
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-22 49
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 5e-22 49
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-22 49
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-22 49
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 5e-22 49
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 2e-22 48
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 4e-20 48
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 3e-20 48
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 2e-22 48
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 2e-22 48
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 2e-22 48
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-20 48
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-20 48
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 2e-22 48
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 4e-20 48
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 6e-20 48
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-22 47
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 4e-22 47
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-22 47
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJAB0715_p0046 YP_008219042.1 Transposase-like protein VFG1603 Protein 1e-21 50
BJAB0715_p0046 YP_008219042.1 Transposase-like protein VFG0606 Protein 1e-21 49
BJAB0715_p0046 YP_008219042.1 Transposase-like protein VFG0643 Protein 2e-22 49
BJAB0715_p0046 YP_008219042.1 Transposase-like protein VFG1717 Protein 2e-20 48