Gene Information

Name : BJAB0868_p0101 (BJAB0868_p0101)
Accession : YP_008215133.1
Strain :
Genome accession: NC_021732
Putative virulence/resistance : Resistance
Product : putative nucleotidyltransferase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4201 - 4992 bp
Length : 792 bp
Strand : +
Note : COG:COG1708

DNA sequence :
ATGAGGGAAGCGGTGATCGCCGAAGTATCGACTCAACTATCAGAGGTAGTTGGCGTCATCGAGCGCCATCTCGAACCGAC
GTTGCTGGCCGTACATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCACACAGTGATATTGATTTGCTGGTTACGG
TGACCGTAAGGCTTGATGAAACAACGCGGCGAGCTTTGATCAACGACCTTTTGGAAACTTCGGCTTCCCCTGGAGAGAGC
GAGATTCTCCGCGCTGTAGAAGTCACCATTGTTGTGCACGACGACATCATTCCGTGGCGTTATCCAGCTAAGCGCGAACT
GCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCAGGTATCTTCGAGCCAGCCACGATCGACATTGATCTGGCTATCT
TGCTGACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTCCAGCGGCGGAGGAACTCTTTGATCCGGTTCCTGAACAG
GATCTATTTGAGGCGCTAAATGAAACCTTAACGCTATGGAACTCGCCGCCCGACTGGGCTGGCGATGAGCGAAATGTAGT
GCTTACGTTGTCCCGCATTTGGTACAGCGCAGTAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGACTGGGCAATGG
AGCGCCTGCCGGCCCAGTATCAGCCCGTCATACTTGAAGCTAGACAGGCTTATCTTGGACAAGAAGAAGATCGCTTGGCC
TCCCGCGCAGATCAGTTGGAAGAATTTGTTCACTACGTGAAAGGCGAGATCACCAAGGTAGTCGGCAAATAA

Protein sequence :
MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDETTRRALINDLLETSASPGES
EILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQ
DLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLA
SRADQLEEFVHYVKGEITKVVGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 3e-118 100
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 2e-118 100
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 3e-118 100
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 2e-118 100
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 3e-118 100
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 2e-118 100
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 3e-118 100
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 2e-118 100
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 3e-118 99
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 3e-118 99
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 9e-119 99
aadA1 AAL08435.1 streptomycin adenyltransferase AadA1 Not tested SRL Protein 4e-112 96
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 5e-111 92
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 9e-106 87
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 9e-106 87
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 2e-106 87
aadA7 AGK06932.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AGK06969.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AGK07015.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AGK07073.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AAR21854.1 aminoglycoside (3'')(9) adenylyltransferase; AAD(3'')(9) Not tested SGI1 Protein 3e-91 72
aadA7 AAT37846.1 aminoglycoside adenyltransferase Not tested Class I integron Protein 3e-91 72
aadA7 AGF35062.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AY123251.gene3.p01 Protein 1e-118 100
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase NC_010410.6003168.p0 Protein 1e-118 100
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AF313471.1.gene3.p01 Protein 1e-118 100
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AY339625.2.gene17.p0 Protein 1e-118 100
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AJ584652.2.gene7.p01 Protein 5e-117 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase FR748153.1.gene5.p01 Protein 2e-118 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase Y18050.2.gene6.p01 Protein 2e-118 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AJ704863.gene12.p01 Protein 9e-107 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AM932669.1.gene3.p01 Protein 2e-116 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase JN596991.2.gene3.p01 Protein 2e-118 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AJ628353.gene.p01 Protein 8e-89 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase NC_010410.6003170.p0 Protein 6e-119 99
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AF047479.2.orf1.gene Protein 1e-107 88
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase EU118119.1.orf1.gene Protein 6e-106 87
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AF294653.1.gene3.p01 Protein 2e-104 87
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AY263741.gene.p01 Protein 6e-104 86
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AF174129.3.gene3.p01 Protein 5e-104 86
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase U37105.2.gene4.p01 Protein 3e-95 76
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase DQ865198.gene.p01 Protein 2e-73 58
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase AY139598.1.gene2.p01 Protein 8e-73 58
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase NC_010558.1.6275994. Protein 2e-73 58
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase NC_003198.gene.p01 Protein 4e-50 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJAB0868_p0101 YP_008215133.1 putative nucleotidyltransferase VFG1026 Protein 2e-112 96