Gene Information

Name : BJAB0868_00281 (BJAB0868_00281)
Accession : YP_008211607.1
Strain : Acinetobacter baumannii BJAB0868
Genome accession: NC_021729
Putative virulence/resistance : Resistance
Product : Permeases of the major facilitator superfamily
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 294451 - 295668 bp
Length : 1218 bp
Strand : -
Note : COG:COG0477

DNA sequence :
ATGAATAGTTCGACAAAGATCGCATTGGTAATTACGTTACTCGATGCCATGGGGATTGGCCTTATCATGCCAGTCTTGCC
AACGTTATTACGTGAATTTATTGCTTCGGAAGATATCGCTAACCACTTTGGCGTATTGCTTGCACTTTATGCGTTAATGC
AGGTTATCTTTGCTCCTTGGCTTGGAAAAATGTCTGACCGATTTGGTCGGCGCCCAGTGCTGTTGTTGTCATTAATAGGC
GCATCGCTGGATTACTTATTGCTGGCTTTTTCAAGTGCGCTTTGGATGCTGTATTTAGGCCGTTTGCTTTCAGGGATCAC
AGGAGCTACTGGGGCTGTCGCGGCATCGGTCATTGCCGATACCACCTCAGCTTCTCAACGCGTGAAGTGGTTCGGTTGGT
TAGGGGCAAGTTTTGGGCTTGGTTTAATAGCGGGGCCTATTATTGGTGGTTTTGCAGGAGAGATTTCACCGCATAGTCCC
TTTTTTATCGCTGCGTTGCTAAATATTGTCACTTTCCTTGTGGTTATGTTTTGGTTCCGTGAAACCAAAAATACACGTGA
TAATACAGATACCGAAGTAGGGGTTGAGACGCAATCGAATTCGGTATACATCACTTTATTTAAAACGATGCCCATTTTGT
TGATTATTTATTTTTCAGCGCAATTGATAGGCCAAATTCCCGCAACGGTGTGGGTGCTATTTACCGAAAATCGTTTTGGA
TGGAATAGCATGATGGTTGGCTTTTCATTAGCGGGTCTTGGTCTTTTACACTCAGTATTCCAAGCCTTTGTGGCAGGAAG
AATAGCCACTAAATGGGGCGAAAAAACGGCAGTACTGCTCGGATTTATTGCAGATAGTAGTGCATTTGCCTTTTTAGCGT
TTATATCTGAAGGTTGGTTAGTTTTCCCTGTTTTAATTTTATTGGCTGGTGGTGGGATCGCTTTACCTGCATTACAGGGA
GTGATGTCTATCCAAACAAAGAGTCATCAGCAAGGTGCTTTACAGGGATTATTGGTGAGCCTTACCAATGCAACCGGTGT
TATTGGCCCATTACTGTTTGCTGTTATTTATAATCATTCACTACCAATTTGGGATGGCTGGATTTGGATTATTGGTTTAG
CGTTTTACTGTATTATTATCCTGCTATCGATGACCTTCATGTTAACCCCTCAAGCTCAGGGGAGTAAACAGGAGACAAGT
TGTCAGTTCCACAAATAA

Protein sequence :
MNSSTKIALVITLLDAMGIGLIMPVLPTLLREFIASEDIANHFGVLLALYALMQVIFAPWLGKMSDRFGRRPVLLLSLIG
ASLDYLLLAFSSALWMLYLGRLLSGITGATGAVAASVIADTTSASQRVKWFGWLGASFGLGLIAGPIIGGFAGEISPHSP
FFIAALLNIVTFLVVMFWFRETKNTRDNTDTEVGVETQSNSVYITLFKTMPILLIIYFSAQLIGQIPATVWVLFTENRFG
WNSMMVGFSLAGLGLLHSVFQAFVAGRIATKWGEKTAVLLGFIADSSAFAFLAFISEGWLVFPVLILLAGGGIALPALQG
VMSIQTKSHQQGALQGLLVSLTNATGVIGPLLFAVIYNHSLPIWDGWIWIIGLAFYCIIILLSMTFMLTPQAQGSKQETS
CQFHK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BJAB07104_00277 YP_008207742.1 Permeases of the major facilitator superfamily Not tested AbaR25 Protein 2e-166 100
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Not tested AbaR26 Protein 2e-166 100
tetA(B) AEQ20905.1 tetracycline resistance protein Not tested Tn6166 Protein 2e-166 100
tetB AEA34667.1 tetracycline resistance determinant Not tested Not named Protein 9e-163 100
tetA(B) AEZ06045.1 tetracycline efflux protein Not tested Tn6167 Protein 1e-162 100
ABZJ_00260 YP_005524216.1 Tetracycline resistance protein, class B (TETA(B) ) (Metal-tetracycline/H(+) antiporter) Not tested AbaR22 Protein 1e-166 100
tetA(B) AFH57202.1 tetracycline resistance protein Not tested AbaR4a Protein 8e-167 100
tetA YP_005797160.1 tetracycline resistance protein, class G (TETA(G)) Not tested AbaR4e Protein 5e-163 99
tetA(B) AAL08445.1 tetracycline resistance protein TetA(B) Not tested SRL Protein 1e-162 99
tet(H) YP_005176248.1 tetracycline efflux protein, class H Not tested ICEPmu1 Protein 6e-77 54
tetA CAJ77034.1 Tetracycline resistance protein Not tested AbaR1 Protein 1e-84 51
tetA(G) AGK07104.1 TetA(G) Not tested SGI1 Protein 3e-81 51
tet(G) AAK02051.1 tetracycline resistance protein Not tested SGI1 Protein 3e-81 51
tetA(G) ABZ01843.1 TetA(G) Not tested SGI2 Protein 3e-81 51
tetA(G) AGK06974.1 TetA(G) Not tested SGI1 Protein 3e-81 51
tetA YP_006098396.1 tetracycline resistance protein Not tested Tn2411 Protein 1e-69 48
tetA(A) ACK44537.1 TetA(A) Not tested SGI1 Protein 1e-69 48
tetA(A) AGK07027.1 TetA(A) Not tested SGI1 Protein 1e-69 48
tetA(A) AGK07085.1 TetA(A) Not tested SGI1 Protein 1e-69 48
tetA(A) ACN81011.1 TetA(A) Not tested AbaR5 Protein 7e-70 48
tetA CAJ77066.1 Tetracycline resistance protein Not tested AbaR1 Protein 5e-70 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily V00611.gene.p01 Protein 6e-162 99
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AB084246.gene.p01 Protein 6e-163 99
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily NC_010558.1.6275971. Protein 7e-163 99
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily L06798.gene.p01 Protein 3e-91 62
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AJ250203.gene.p01 Protein 4e-82 58
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Y19116.gene.p01 Protein 2e-78 55
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily L06940.gene.p01 Protein 3e-79 55
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Y15510.gene.p01 Protein 8e-78 54
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily CP004022.1.gene2534. Protein 2e-78 54
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AF038993.gene.p01 Protein 2e-78 54
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AF133139.gene.p01 Protein 4e-83 51
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily NC_010410.6002612.p0 Protein 9e-85 51
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AF133140.gene.p01 Protein 9e-85 51
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily NC_011586.7045189.p0 Protein 4e-66 48
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily CP001485.1.gene2821. Protein 3e-70 48
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AF534183.gene.p01 Protein 2e-70 48
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily NC_010410.6002597.p0 Protein 3e-70 48
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Y19114.gene.p01 Protein 1e-68 47
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily X75761.gene.p01 Protein 1e-69 47
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AF121000.gene.p01 Protein 2e-62 45
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AF070999.gene.p01 Protein 3e-67 45
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AY264780.2.gene3.p01 Protein 1e-62 44
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AJ420072.gene.p01 Protein 8e-59 44
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily AY743590.gene.p01 Protein 1e-59 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily VFG1036 Protein 6e-163 99