Gene Information

Name : LOCK908_2894 (LOCK908_2894)
Accession : YP_008207357.1
Strain : Lactobacillus rhamnosus LOCK908
Genome accession: NC_021725
Putative virulence/resistance : Virulence
Product : Two-component response regulator SA14-24
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2870834 - 2871550 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
ATGATGGCGAAAAAAATCTTGGTCGTTGACGATGAGAAGCCTATCTCTGATATCGTCAAGTTTAATTTGGATAAAGAAGG
CTATGATGTCGTCACTGCATATGATGGCGAAGAAGCCTTGAAGAAAGTCGAATCAGAATCACCTGATTTGATTTTACTTG
ATTTGATGTTACCGAAAATTGATGGGCTTGAAGTTGCCCGACAAATTCGTAAAGAACATGACACGCCGATTATTATGCTG
ACGGCGAAGGATTCCGAAATTGATAAAGTGTTAGGACTGGAGCTTGGGGCAGATGATTATGTTACCAAGCCGTTTTCCAA
TCGAGAACTTGTTGCGCGGGTGAAAGCTAACTTGCGCCGTACCTCATCAGCCAATGCTGCCGGCAGTGAGGAAGACGAAG
CCAATCGTGAATTGGAAGTTGGCGATTTAACGATTCATCCGGACGCATATACGGTATCCAAACGCGGTGAGAATATCGAA
TTAACCCACCGCGAGTTTGAATTGCTGCATTACCTTGCCCGCCACTTGGGACAGGTTATGACCCGCGAACATCTGCTACA
GACAGTTTGGGGCTATGACTACTTTGGCGATGTCCGGACTGTGGATGTGACGGTTCGCCGCCTCCGCGAAAAGATCGAAG
ACAATCCGTCCCATCCTGAGTGGTTGGTGACCCGACGCGGCGTAGGCTATTATTTGCGAAATCCTGACGCTGAATAA

Protein sequence :
MMAKKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALKKVESESPDLILLDLMLPKIDGLEVARQIRKEHDTPIIML
TAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRRTSSANAAGSEEDEANRELEVGDLTIHPDAYTVSKRGENIE
LTHREFELLHYLARHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPEWLVTRRGVGYYLRNPDAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-33 42
kdpE NP_373306.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-25 41
kdeP YP_190033.1 DNA-binding response regulator KdeP Not tested Type-II SCCmec Protein 2e-25 41
SH0031 YP_251946.1 hypothetical protein Not tested SCCmec Protein 8e-26 41
kdpE BAA82188.1 KDP operon transcriptional regulatory protein KdpE Not tested Type-II SCCmec Protein 2e-25 41
kdpE YP_039536.1 response regulator protein Not tested Type-II SCCmec Protein 2e-25 41
kdpE NP_370594.1 transcriptional regulator kdpE Not tested Type-II SCCmec Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_012469.1.7685629. Protein 8e-72 72
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002952.2859905.p0 Protein 3e-55 55
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002951.3237708.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_003923.1003749.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002758.1121668.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_009641.5332272.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_013450.8614421.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_007793.3914279.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_007622.3794472.p0 Protein 2e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002745.1124361.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_009782.5559369.p0 Protein 1e-55 54
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 HE999704.1.gene2815. Protein 3e-49 53
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_012469.1.7686381. Protein 4e-44 49
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 AE016830.1.gene1681. Protein 5e-48 48
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 FJ349556.1.orf0.gene Protein 3e-41 48
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 AF155139.2.orf0.gene Protein 6e-40 46
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 AF162694.1.orf4.gene Protein 3e-36 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002695.1.915041.p Protein 1e-35 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP000034.1.gene3834. Protein 1e-35 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP001918.1.gene5135. Protein 3e-31 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP004022.1.gene3215. Protein 5e-39 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_003923.1003417.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_013450.8614146.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002951.3238224.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_007793.3914065.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002758.1121390.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_010079.5776364.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002952.2859858.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_007622.3794948.p0 Protein 8e-38 45
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP000647.1.gene4257. Protein 3e-35 44
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP001138.1.gene4273. Protein 2e-35 44
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 BAC0533 Protein 3e-35 44
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 AM180355.1.gene1830. Protein 8e-40 44
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 AE000516.2.gene3505. Protein 6e-37 44
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 EU250284.1.orf4.gene Protein 7e-38 43
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 DQ212986.1.gene4.p01 Protein 4e-39 43
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 AE015929.1.gene1106. Protein 7e-31 43
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 BAC0039 Protein 7e-31 43
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP000034.1.gene2186. Protein 7e-31 43
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_002695.1.916589.p Protein 5e-31 43
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 AF130997.1.orf0.gene Protein 3e-37 42
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP001918.1.gene3444. Protein 2e-29 42
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 BAC0596 Protein 2e-29 42
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 CP001138.1.gene2239. Protein 2e-29 42
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 HE999704.1.gene1528. Protein 9e-30 41
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_011586.7046392.p0 Protein 1e-23 41
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 NC_010410.6002907.p0 Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 VFG1389 Protein 2e-31 44
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 VFG1563 Protein 5e-33 42
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 VFG1702 Protein 4e-33 42
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 VFG1390 Protein 9e-35 41
LOCK908_2894 YP_008207357.1 Two-component response regulator SA14-24 VFG1386 Protein 8e-33 41