Gene Information

Name : I876_04990 (I876_04990)
Accession : YP_008195414.1
Strain : Alteromonas macleodii Ionian Sea U7
Genome accession: NC_021717
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1156685 - 1157041 bp
Length : 357 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
GTGAATGTCGAAACTATCCGCTTTTACGAGCGCAAAAGTTTAATTGAACAGCCCACAAAGCCAGAAACAGGCTACCGACA
CTACTCTGATGAAATAGTTAACAGAGTCAGATTTATCAAAAGAACCCAAGAACTAGGTTTTTCTCTAAAGGAGATCGAGA
ATCTACTCAAATTAAACGACTCCCCGTGTAGCCAAGTTCAAGATTTGGCTGAAGCCAAGCTAGAATCTGTAGCCGATAAG
ATCAGTGATTTAAAAAAATTACAAAAGGCGTTAACCGAGTTGGTTGGTTTATGTCATTCTAATGCCGATAAAAACACCTG
CCCAGTCATTGACTCACTTCAACCGAATTCAAAATAA

Protein sequence :
MNVETIRFYERKSLIEQPTKPETGYRHYSDEIVNRVRFIKRTQELGFSLKEIENLLKLNDSPCSQVQDLAEAKLESVADK
ISDLKKLQKALTELVGLCHSNADKNTCPVIDSLQPNSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-27 48
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-27 48
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 3e-26 47
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-26 47
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-26 47
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-26 47
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-26 47
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-26 47
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-26 47
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 7e-24 43
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 9e-21 41
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 6e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0688 Protein 1e-27 49
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0684 Protein 6e-28 48
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0687 Protein 4e-27 48
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0232 Protein 4e-27 48
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0686 Protein 7e-28 48
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0683 Protein 1e-27 47
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0682 Protein 2e-23 45
I876_04990 YP_008195414.1 MerR family transcriptional regulator BAC0689 Protein 1e-26 45