Gene Information

Name : I607_04775 (I607_04775)
Accession : YP_008171021.1
Strain : Alteromonas macleodii Ionian Sea U4
Genome accession: NC_021710
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1066957 - 1067349 bp
Length : 393 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGGTAGCAGTTGCTCGATATCGGAAAGAAGTTGGGGTGAATGTCGAAACTATCCGCTTTTACGAGCGCAAAAGTTTAAT
TGAACAGCCCACAAAGCCAGAAACAGGCTACCGACACTACTCTGATGAAATAGTTAACAGAGTCAGATTTATCAAAAGAA
CCCAAGAACTAGGTTTTTCTCTAAAGGAGATCGAGAATCTACTCAAATTAAACGACTCCCCGTGTAGCCAAGTTCAAGAT
TTGGCTGAAGCCAAGCTAGAATCTGTAGCCGATAAGATCAGTGATTTAAAAAAATTACAAAAGGCGTTAACCGAGTTGGT
TGGTTTATGTCATTCTAATGCCGATAAAAACACCTGCCCAGTCATTGACTCACTTCAACCGAATTCAAAATAA

Protein sequence :
MVAVARYRKEVGVNVETIRFYERKSLIEQPTKPETGYRHYSDEIVNRVRFIKRTQELGFSLKEIENLLKLNDSPCSQVQD
LAEAKLESVADKISDLKKLQKALTELVGLCHSNADKNTCPVIDSLQPNSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 9e-30 47
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 6e-30 47
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-28 45
merR AFG30124.1 MerR Not tested PAGI-2 Protein 5e-29 45
merR AGK07025.1 MerR Not tested SGI1 Protein 5e-29 45
merR AGK07083.1 MerR Not tested SGI1 Protein 5e-29 45
merR ACK44535.1 MerR Not tested SGI1 Protein 5e-29 45
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 5e-29 45
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 8e-29 45
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 2e-21 42
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 3e-21 42
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0688 Protein 6e-30 47
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0686 Protein 4e-30 47
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0684 Protein 3e-30 46
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0232 Protein 2e-29 46
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0687 Protein 2e-29 46
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0682 Protein 2e-24 46
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0683 Protein 6e-30 45
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0689 Protein 8e-29 44
I607_04775 YP_008171021.1 MerR family transcriptional regulator BAC0680 Protein 9e-22 41